Recombinant Rat Neuromedin-K receptor (Tacr3)

Shipped with Ice Packs
In Stock

Description

Physiological Roles

  • Neuromodulation: Tacr3 is densely expressed in dopaminergic neurons of the rat ventral tegmental area (A8–A10), where it modulates neurotransmission .

  • Synaptic Plasticity: Inhibition of Tacr3 in rat hippocampal neurons increases spine density and disrupts long-term potentiation (LTP), implicating its role in synaptic connectivity .

  • Hormonal Regulation: Tacr3 expression fluctuates with sex hormone levels (e.g., testosterone), and its deficiency correlates with anxiety-like behaviors and hypogonadism .

Disease Implications

  • Hypogonadotropic Hypogonadism: Mutations in TACR3 are linked to delayed puberty and reproductive dysfunction due to impaired neurokinin B signaling .

  • Psychiatric Disorders: Altered Tacr3 activity is associated with anxiety and impaired stress responses in rodent models .

Research Applications

  • Drug Development: Used to screen antagonists like SR 142801, which inhibit Tacr3-mediated phosphatidylinositol-calcium signaling .

  • Mechanistic Studies: Recombinant Tacr3 enables exploration of neurokinin B’s role in pain perception, gut motility, and hormone release .

  • Structural Biology: Facilitates crystallography studies to map ligand-binding domains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tacr3; Tac3r; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
Uniprot No.

Target Background

Function
This receptor is responsible for recognizing the tachykinin neuropeptide neuromedin-K (neurokinin B). It is coupled to G proteins, which activate a phosphatidylinositol-calcium second messenger system. The affinity of this receptor for tachykinins follows this order: neuromedin-K > substance K > substance P.
Gene References Into Functions
  1. The varying effects of different long-term exercise intensities on the male pituitary-gonadal axis may be mediated by changes in hypothalamic Nkb and Pdyn gene expressions. PMID: 30207304
  2. Research findings support the involvement of NK3 receptors in the anxiogenic-like actions of SP6-11(C-terminal), where this metabolite appears to act as an antagonist, similar to SR142801. PMID: 26851555
  3. Median preoptic nucleus NK3R neurons facilitate cutaneous vasodilation, an important mechanism for heat dissipation. PMID: 25825817
  4. Data suggest that endogenous NeuroKinin B-Neurokinin 3 Receptor signaling plays a role in regulating the timing of puberty. PMID: 24863620
  5. Research indicates that the suppression of the GnRH pulse generator by acute systemic stress involves hypothalamic NKB/neurokinin B (NKB) receptor (NK3R) signaling. PMID: 24708241
  6. Evidence suggests that neurokinin3 receptors (NK3-R) and their influence on acetylcholine release may be a crucial mechanism underlying age-related deficits in learning and memory. PMID: 23983264
  7. Activation of the NK3R appears to engage multiple pathways, including acetylation, and possibly histone deacetylases, histone methylases, or DNA methylases to influence chromatin structure and gene expression. PMID: 22985858
  8. Data provide unique evidence that KNDy neurons promote cutaneous vasodilatation and participate in the E(2) modulation of body temperature. PMID: 23150555
  9. Nkr3 peptide may exacerbate 6-OHDA toxicity in an in-vivo model, by modulating N-methyl-D-aspartate receptor (Grin)1 subunit and c-Jun N-terminal kinase (JNK) pathway activities. PMID: 22762252
  10. Given the widespread distribution of NK3-R in the CNS, its presence in nuclei from multiple brain regions suggests a broad influence on CNS gene expression in a ligand-dependent manner. PMID: 21939739
  11. In response to hyperosmolarity, NK3R is transported to the nucleus of paraventricular hypothalamic neurons and associates with acetylated histone H3 and H4. PMID: 21697521
  12. Research suggests that NKB/NK3R signaling in kisspeptin+ neurons in the arcuate nucleus plays a crucial role in controlling GnRH/LH secretion. NKB and NK3R mRNAs are widely expressed in the central forebrain. PMID: 21045176
  13. In response to acute hyperosmotic challenge, NK3R associates with importin ss-1, which enables the nuclear transport of NK3R. PMID: 20709160
  14. Heterologous and homologous desensitization of NK3-R-mediated contractility is dependent upon the duration of exposure to estrogen. PMID: 12390879
  15. NK3 receptors exhibit a distinct distribution in the caudal half of the solitary nucleus, suggesting a specific role in processing taste input from the posterior tongue. PMID: 15121234
  16. The NK3R receptor plays a role in transcriptional regulation in hypotension-induced tachykinin release in the supraoptic nucleus. PMID: 15537880
  17. These data suggest that NKB neurons could indirectly influence anterior pituitary function by inputs to arcuate neuroendocrine neurons, but through a receptor other than NK3R. PMID: 16025449
  18. NK(3) receptors are available in cytoplasmic reserve in dopaminergic neurons, but more immediately accessible at the plasmalemmal surface of non-dopaminergic dendrites in both the SN and VTA. PMID: 17197098
  19. Data provide evidence that neurokinin 3 receptors are involved in the control of the hyperlocomotor and nucleus accumbens dopamine response to cocaine, but not in cocaine-induced conditioned place preference. PMID: 17445241
  20. NK3R activation contributes significantly to the systemic release of both vasopressin and oxytocin in response to osmotic and hypotensive challenges. PMID: 17522129
  21. NK3R signaling in magnocellular neurons has a critical role for the release of VP and OT in response to hypotension. PMID: 18650316

Show More

Hide All

Database Links

KEGG: rno:24808

STRING: 10116.ENSRNOP00000012473

UniGene: Rn.9702

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Structure and Function of Rat Tacr3

Q: What is the molecular structure of rat Tacr3 and how does it function as a receptor?

Rat Neuromedin-K receptor (Tacr3) is a G protein-coupled receptor consisting of 452 amino acid residues with seven transmembrane domains. The receptor shows highest binding affinity for neuromedin K, followed by substance K and substance P .

Tacr3 belongs to the tachykinin receptor family and specifically responds to neurokinin B (NKB) as its high-affinity endogenous ligand. The receptor is highly conserved in the seven transmembrane domains and the cytoplasmic sides, with characteristic histidine residues in transmembrane segments V and VI .

When activated, Tacr3 primarily signals through the phosphatidylinositol-calcium second messenger system, which can lead to increased intracellular Ca²⁺ concentration, inositol phosphate generation, inhibition of forskolin-stimulated cAMP generation, and ERK (MAPK/ERK pathway) activation . These signaling pathways have been established through experiments on transfected cell lines including HEK-293, COS-7, and CHO cells.

Expression Systems for Recombinant Rat Tacr3 Production

Q: What are the most effective expression systems for producing functional recombinant rat Tacr3, and what technical considerations should researchers account for?

Several expression systems have proven effective for producing recombinant rat Tacr3:

E. coli Expression System:
Recombinant rat Tacr3 can be successfully produced as a full-length protein (1-452 amino acids) with an N-terminal 10xHis-tag in bacterial systems . This approach is efficient for generating larger quantities of protein, though potential limitations exist regarding post-translational modifications.

Mammalian Cell Expression:
For studies requiring properly folded and functional receptors, mammalian expression systems using HEK-293, COS-7, or CHO cell lines have been successfully employed . These systems allow for appropriate post-translational modifications and membrane insertion.

Cloning and Vector Strategies:
For specific research applications, rat Tacr3 constructs can be created with fluorescent tags. For example, rat Tacr3-mCherry can be sub-cloned from synthesized templates using specific primers (GCTCTAGAGCCACCATGGCCTCAGTCC, AACATGCATGCTTACTTGTACAGCTCGTCC) and cloned into vectors such as the Sindbis vector pSinRep5 . Similarly, rat Tacr3-IRES-EGFP constructs can be created using primers GACTAGTGCCACCATGGCCTCAGTCC and GCACTGCAGTTAGGAATATTCATCCACAGAGGTA .

Technical Considerations:

  • Storage conditions affect protein stability: for liquid form, maintain at -20°C/-80°C with a shelf life of approximately 6 months; lyophilized form has a longer shelf life of 12 months

  • Repeated freezing and thawing should be avoided; working aliquots can be stored at 4°C for up to one week

  • The choice of purification method and tags should be considered based on the specific experimental goals

Tacr3 Signaling Mechanisms and Experimental Approaches

Q: What are the primary signaling pathways associated with Tacr3 activation, and how can these be experimentally investigated?

Primary Signaling Pathways:
Upon activation by neurokinin B or other tachykinins, Tacr3 activates multiple signaling cascades:

  • Gαq-mediated pathway leading to increased intracellular Ca²⁺ and inositol phosphate generation

  • Gαi-mediated signaling (particularly for NMUR2)

  • Inhibition of forskolin-stimulated cAMP production

  • Activation of the MAPK/ERK pathway

Methodological Approaches for Investigation:

1. Calcium Signaling Analysis:

  • Real-time calcium imaging in cultured cells expressing Tacr3

  • Quantification of calcium flux using fluorescent indicators

2. G-protein Coupling Assessment:

  • FRET-based assays to measure G-protein dissociation following ligand binding, as demonstrated with R295S mutant NK3R which showed impaired dissociation of Gαq-protein subunits compared to wild-type receptors

  • Analysis of downstream effectors specific to different G-protein pathways

3. Phosphorylation Studies:

  • Western blotting to detect phosphorylation of ERK and other signaling molecules

  • Investigation of CaMKII activation and AMPA receptor phosphorylation, which are affected by Tacr3 inhibition

4. Electrophysiological Approaches:

  • Patch-clamp recordings to measure electrical responses in neurons or expression systems like Xenopus oocytes following receptor activation

  • Multielectrode arrays to measure neural connectivity and cross-correlation of firing among neurons, which can detect network-level effects of Tacr3 modulation

5. Measurement of Second Messengers:

  • Quantification of inositol phosphate generation

  • cAMP assays to detect inhibition of adenylyl cyclase activity

These experimental approaches have revealed that signaling pathways may be modified by factors such as receptor recirculation rates , highlighting the importance of considering temporal dynamics in experimental design.

Tacr3 in Reproduction and Neuroendocrine Function

Q: How does Tacr3 contribute to reproductive and neuroendocrine functions, and what methodological approaches best address this relationship?

Tacr3's Role in Reproduction:
Tacr3 is critical for normal reproductive development and function. Loss-of-function mutations in TACR3/Tacr3 are associated with hypogonadotropic hypogonadism, delayed puberty, and amenorrhea . Animal models with deficient Tacr3 activity exhibit lower serum testosterone levels , demonstrating the receptor's importance in regulating reproductive hormones.

Neuroendocrine Functions:
Tacr3 is highly expressed in the supraoptic and paraventricular nuclei, where it likely mediates the release of vasopressin and oxytocin into circulation following binding of its ligand . This positions Tacr3 as a key regulator of neuroendocrine processes.

Optimal Methodological Approaches:

1. Genetic Analysis:

  • Genotype-phenotype correlation studies examining specific mutations in Tacr3 (similar to studies in humans )

  • Creation of genetic models with targeted mutations in reproductive pathway genes

2. Hormone Profiling:

  • Comprehensive measurement of reproductive hormones including testosterone, estrogen, LH, FSH, and GnRH

  • Assessment of Tacr3 expression fluctuations during the estrous cycle in female rats

3. Developmental Studies:

  • Analysis of Tacr3 expression during sexual development, which is associated with substantial increases in hippocampal Tacr3 expression coinciding with elevated testosterone and reduced anxiety

  • Longitudinal assessment of pubertal development in models with Tacr3 manipulation

4. Sex-Specific Analysis:

  • Comparative studies between males and females to capture sex-specific effects

  • Tracking of estrous cycle in females and controlling for cycle stage in experimental designs

5. Pharmacological Manipulation:

  • Use of specific Tacr3 agonists or antagonists to assess effects on reproductive function

  • Hormone replacement studies, as testosterone treatment has been shown to rectify aberrant neuronal firing patterns in models with defective Tacr3

These approaches allow for a comprehensive understanding of Tacr3's complex role in the reproductive axis and its interactions with sex hormones.

Tacr3 Mutations and Functional Consequences

Q: What types of Tacr3 mutations have been identified, and how do they affect receptor function?

Types of Mutations and Their Functional Effects:

Research on NK3R/Tacr3 mutations has identified several types of mutations with distinct functional consequences:

1. Transmembrane Domain Mutations:

  • Y256H mutation in the fifth transmembrane domain (TM5) results in reduced whole-cell receptor levels (79.3±7.2% compared to wild-type) with near-complete loss of inositol phosphate (IP) signaling

  • Y315C mutation in the sixth transmembrane domain (TM6) leads to reduced plasma membrane levels (67.3±7.3% compared to wild-type) with severely impaired signaling

  • These mutations implicate TM5 and TM6 in receptor trafficking, processing, stability, and ligand binding

2. Intracellular Loop Mutations:

  • R295S mutation in the third intracellular loop (IL3) maintains the ability to bind NKB but impairs the dissociation of Gαq-protein subunits from the receptor

  • In FRET-based assays, wild-type NK3R showed a 10.0±1.3% reduction in FRET ratios following ligand binding (indicating G-protein activation), which was not observed with the R295S mutant

  • This mutation demonstrates the critical role of IL3 in receptor-mediated signal transduction

3. Dominant-Negative Effects:

  • R295S NK3R, identified in the heterozygous state in a GnRH-deficient patient, interferes with wild-type NK3R function, showing dominant-negative effects on G-protein dissociation and IP signaling

  • This explains how heterozygous mutations can produce clinical phenotypes

Methodological Approaches for Studying Mutations:

1. Recombinant Expression Systems:

  • Expression of mutant receptors in cell lines (HEK-293, COS-7) for functional characterization

  • Comparison of mutant and wild-type receptors in the same experimental system

2. Quantitative Assays:

  • Measurement of whole-cell and plasma membrane receptor levels

  • Determination of ligand binding affinity and capacity

  • Assessment of dose-dependent activation of signaling pathways

3. Structural Analysis:

  • Identification of critical domains for receptor function

  • Correlation of mutation location with specific functional defects

4. Co-expression Studies:

  • Analysis of interactions between mutant and wild-type receptors to identify dominant-negative effects

  • Assessment of potential therapeutic approaches to overcome mutation effects

Understanding these mutation effects has significant implications for reproductive disorders in humans and provides insights into structure-function relationships of the receptor.

Tacr3's Role in Learning, Memory, and Anxiety

Q: What evidence links Tacr3 to learning, memory, and anxiety, and what experimental approaches best assess these functions?

Evidence for Tacr3's Role in Cognitive and Emotional Functions:

Research has established important links between Tacr3 and cognitive/emotional processes:

Learning and Memory:

  • Pharmacological stimulation of NK3R improves learning in the water maze and object-place recognition tasks in aged rats

  • A single-nucleotide polymorphism (SNP) in the TACR3 gene can predict learning and memory performance in elderly patients with cognitive impairments

  • NK3R stimulation enhances in vivo acetylcholinergic activity in the frontal cortex, hippocampus, and amygdala, which is associated with cognitive function

Anxiety:

  • Severe anxiety in animal models is linked to dampened Tacr3 expression in the ventral hippocampus

  • Sexual development is associated with increased hippocampal Tacr3 expression, coinciding with elevated serum testosterone and reduced anxiety

  • Recent research has revealed a significant connection between anxiety disorders and Tacr3, with testosterone administration potentially correcting deficiencies resulting from Tacr3 inactivity

Experimental Approaches:

1. Behavioral Testing:

  • Water maze and object-place recognition tasks to assess spatial and recognition memory

  • Standard anxiety tests (elevated plus maze, open field, light-dark box) to measure anxiety-like behaviors

  • Novel applications of cross-correlation to measure neural connectivity within multi-electrode array systems, revealing the impact of Tacr3 manipulations on synaptic plasticity

2. Neurochemical Analysis:

  • Measurement of acetylcholine release in brain regions associated with cognition

  • Assessment of how Tacr3 modulation affects neurotransmitter systems

3. Electrophysiological Approaches:

  • Evaluation of long-term potentiation (LTP) in the hippocampus, which is impaired with deficient Tacr3 activity

  • Analysis of firing patterns in response to LTP induction, which are aberrant in neurons expressing defective Tacr3 but can be rectified by testosterone treatment

4. Structural Analysis:

  • Examination of spine density and morphology, as deficient Tacr3 activity leads to increased spine density while functional Tacr3 expression in spines results in spine shrinkage and pruning

  • Assessment of how these structural changes correlate with behavioral outcomes

5. Genetic Association Studies:

  • Investigation of SNPs in the Tacr3 gene and their association with cognitive performance and anxiety traits

  • Cross-species validation of findings from human studies in animal models

6. Hormone Manipulation:

  • Testing the effects of testosterone administration on Tacr3-related cognitive and emotional phenotypes

  • Investigation of the bidirectional relationship between Tacr3 and sex hormones

These approaches collectively provide a comprehensive understanding of Tacr3's role in learning, memory, and anxiety, with implications for treating anxiety associated with testosterone deficiency.

Advanced Techniques for Monitoring Tacr3 Expression and Activity

Q: What cutting-edge methods can researchers employ to monitor Tacr3 expression and activity in experimental settings?

Advanced Techniques for Monitoring Tacr3:

1. Fluorescent Tagging and Live Imaging:

  • Creation of rat Tacr3-mCherry constructs using specific primers (GCTCTAGAGCCACCATGGCCTCAGTCC, AACATGCATGCTTACTTGTACAGCTCGTCC) and cloning into vectors like Sindbis pSinRep5

  • Development of Tacr3-IRES-EGFP constructs for simultaneous expression of the receptor and a fluorescent reporter

  • Real-time visualization of receptor trafficking and localization in living neurons

2. Multi-electrode Array (MEA) Technology:

  • Application of MEAs to measure cross-correlation of firing among neurons following Tacr3 manipulation

  • Novel application of cross-correlation analysis to quantify neural connectivity changes in response to Tacr3 activity modulation

  • Spatial and temporal mapping of network-level effects of Tacr3 signaling

3. FRET-based Assays for Protein Interactions:

  • Measurement of G-protein dissociation following ligand binding to Tacr3

  • Wild-type NK3R shows a 10.0±1.3% reduction in FRET ratios after ligand binding, indicating activation of G-protein signaling

  • Quantification of protein-protein interactions in the Tacr3 signaling pathway

4. Advanced Microscopy for Structural Analysis:

  • High-resolution imaging to examine changes in spine density and morphology associated with Tacr3 activity

  • Deficient Tacr3 activity increases spine density, while functional Tacr3 expression in spines causes spine shrinkage and pruning

  • Correlation of structural changes with functional outcomes

5. Molecular Genetic Tools:

  • CRISPR/Cas9 gene editing for precise manipulation of Tacr3 expression

  • Creation of conditional knockout models for temporal and spatial control of Tacr3 expression

  • Single-cell RNA sequencing to identify cell-specific expression patterns

6. Protein-Protein Interaction Analysis:

  • Mass spectrometry-based approaches to identify Tacr3 interaction partners

  • Proximity labeling techniques to capture transient interactions in the signaling pathway

  • Understanding the broader signaling network regulated by Tacr3

7. In vivo Microdialysis and Biosensors:

  • Real-time measurement of neurotransmitter release associated with Tacr3 activation

  • Assessment of acetylcholinergic activity, which is enhanced by NK3R stimulation

  • Correlation of neurochemical changes with behavioral outcomes

These advanced techniques provide comprehensive insights into Tacr3 expression, localization, and function, allowing for a more complete understanding of its role in various physiological processes.

Challenges in Isolating Direct Tacr3 Effects from Indirect Pathways

Q: What methodological strategies can differentiate between direct Tacr3-mediated effects and indirect consequences through other signaling systems?

Isolating direct Tacr3 effects from indirect consequences presents significant challenges due to the complex interplay between Tacr3 signaling and other physiological systems. Several methodological strategies can help differentiate these effects:

1. Temporal Resolution Analysis:

  • Implement high-speed calcium imaging or electrophysiological recordings to capture immediate responses (milliseconds to seconds) following Tacr3 activation

  • Construct detailed time-course studies to distinguish primary (direct) from secondary (indirect) signaling events

  • Account for receptor recirculation rates, which can modify signaling pathways induced by Tacr3 stimulation

2. Pharmacological Dissection:

  • Apply specific inhibitors at different points in the signaling cascade to isolate direct Tacr3 effects

  • Utilize selective NK3R antagonists alongside inhibitors of downstream pathways

  • Perform dose-response studies to establish pharmacological profiles characteristic of direct receptor activation

3. Genetic Approaches:

  • Create cell-type specific Tacr3 knockout or knockdown models to examine receptor function in isolated cellular populations

  • Employ point mutations that affect specific aspects of receptor function (e.g., R295S affects G-protein signaling but not ligand binding)

  • Develop rescue experiments where downstream components are manipulated to reverse Tacr3-mediated effects

4. Advanced Imaging Techniques:

  • Implement subcellular resolution imaging focusing on the cell membrane and presynaptic compartment where Tacr3 is predominantly expressed

  • Use FRET-based assays to directly visualize protein-protein interactions in the signaling pathway

  • Correlate receptor activation with specific cellular responses at high spatial resolution

5. Ex Vivo and Reduced Preparations:

  • Study Tacr3 function in isolated systems (e.g., hippocampal slices) to minimize confounding influences

  • Compare findings from in vitro cell models with in vivo observations to identify consistent direct effects

  • Systematically increase system complexity to track when indirect effects emerge

6. Multi-level Analysis:

  • Examine Tacr3 effects at multiple levels from molecular (G-protein coupling, calcium signaling) to cellular (spine density, neuron firing) to behavioral outcomes

  • Construct causal models linking observations across levels of analysis

  • Identify points where intervention at one level fails to propagate to others, suggesting indirect mechanisms

7. Hormone Interaction Studies:

  • Design testosterone replacement studies to determine which Tacr3-related phenotypes can be rescued by hormone treatment

  • Investigate the bidirectional relationship between Tacr3 and sex hormones, as deficient Tacr3 activity leads to lower testosterone levels

  • Use gonadectomy with controlled hormone replacement to establish causal relationships

These methodological strategies, particularly when used in combination, can help researchers differentiate between direct Tacr3-mediated effects and those occurring through indirect pathways.

Tacr3 and Synaptic Plasticity

Q: How does Tacr3 modulate synaptic plasticity, and what experimental paradigms best capture these mechanisms?

Tacr3's Role in Synaptic Plasticity:

Research has revealed several important mechanisms by which Tacr3 modulates synaptic plasticity:

1. Regulation of Spine Morphology:

  • Deficient Tacr3 activity leads to increased spine density in the hippocampus

  • Expression of functional Tacr3 in spines results in spine shrinkage and pruning

  • Expression of defective Tacr3 increases spine density, size, and cross-correlation magnitude

2. Effects on Long-Term Potentiation (LTP):

  • Deficient Tacr3 activity impairs LTP in the dentate gyrus of the hippocampus

  • Neurons expressing defective Tacr3 show inadequate firing patterns in response to LTP induction

  • Testosterone treatment can rectify these aberrant firing patterns

3. Modulation of Synaptic Signaling:

  • Inhibition of Tacr3 activity provokes hyperactivation of CaMKII

  • Enhanced AMPA receptor phosphorylation occurs following Tacr3 inhibition

  • These molecular changes are associated with increased spine density

4. Influence on Neural Connectivity:

  • Stronger cross-correlation of firing is evident among neurons following Tacr3 inhibition

  • This indicates enhanced connectivity within neural networks

  • The effect suggests that Tacr3 normally constrains certain aspects of synaptic communication

Optimal Experimental Paradigms:

1. Electrophysiological Approaches:

  • Field potential recordings to assess LTP in hippocampal slices or in vivo

  • Paired-pulse facilitation protocols to examine presynaptic function

  • Whole-cell patch-clamp recordings to measure synaptic strength at individual connections

2. Multi-electrode Array (MEA) Analysis:

  • Recording from multiple neurons simultaneously to assess network-level effects

  • Application of novel cross-correlation analyses to quantify changes in neural connectivity

  • Investigation of how Tacr3 modulation affects spatiotemporal patterns of activity

3. Advanced Microscopy:

  • High-resolution imaging of dendritic spines to quantify changes in density, size, and morphology

  • Time-lapse imaging to track dynamic changes in spine structure following Tacr3 manipulation

  • Correlation of structural changes with functional measurements

4. Molecular Signaling Analysis:

  • Western blotting to assess CaMKII activation and AMPA receptor phosphorylation

  • Immunohistochemistry to examine the spatial distribution of signaling changes

  • Biochemical assays to measure activity-dependent protein synthesis

5. Combined Genetic and Pharmacological Approaches:

  • Expression of fluorescently tagged wild-type or mutant Tacr3 constructs

  • Application of Tacr3 agonists or antagonists during plasticity paradigms

  • Rescue experiments with testosterone or other interventions

6. Behavioral Correlates:

  • Assessment of learning and memory tasks dependent on hippocampal plasticity

  • Correlation of electrophysiological or structural findings with behavioral outcomes

  • Investigation of how Tacr3-dependent plasticity changes contribute to cognitive performance

These experimental paradigms, particularly when combined in multimodal approaches, provide comprehensive insights into Tacr3's role in synaptic plasticity.

Translational Relevance of Tacr3 Research

Q: How can findings from rat Tacr3 studies be effectively translated to human health applications, and what methodological considerations ensure translational validity?

Translational Relevance of Tacr3 Research:

Research on rat Tacr3 has significant translational implications for human health in several domains:

1. Reproductive Health and Development:

  • Mutations in human TACR3 are associated with hypogonadotropic hypogonadism, delayed puberty, and amenorrhea

  • Rat models with Tacr3 manipulation can provide mechanistic insights into these disorders

  • Understanding Tacr3's role in reproductive development may lead to improved diagnostics and treatments for pubertal disorders

2. Cognitive Enhancement:

  • NK3R stimulation improves learning and memory in aged rats

  • A SNP in human TACR3 can predict learning and memory in elderly patients with cognitive impairments

  • These findings suggest Tacr3 as a potential biomarker and treatment target for cognitive enhancement in the elderly

3. Anxiety and Mood Disorders:

  • Severe anxiety is linked to dampened Tacr3 expression in the ventral hippocampus

  • Research has revealed connections between anxiety disorders, Tacr3, and testosterone levels

  • Testosterone treatments could improve quality of life for people coping with sexual development disorders and associated anxiety and depression

Methodological Approaches for Ensuring Translational Validity:

1. Comparative Genomics and Protein Structure:

  • Sequence analysis comparing rat Tacr3 (452 amino acids) with human TACR3

  • Identification of conserved domains critical for receptor function

  • Focus on mutations in conserved regions that are likely to have similar effects across species

2. Cross-Species Validation:

  • Testing of findings from rat studies in human cell lines or tissues

  • Investigation of whether SNPs identified in human genetic studies (like rs2765 ) affect receptor function in rat models

  • Comparative pharmacology to ensure that drug effects are consistent across species

3. Disease-Relevant Phenotyping:

  • Development of rat models that recapitulate specific aspects of human conditions

  • For example, creating models with Tacr3 mutations similar to those found in patients with hypogonadotropic hypogonadism

  • Assessment of whether interventions that improve phenotypes in rats (e.g., testosterone treatment ) might be effective in humans

4. Translational Biomarkers:

  • Identification of biomarkers (e.g., hormone levels, receptor expression, spine density) that can be measured in both rats and humans

  • Development of imaging or electrophysiological markers that bridge preclinical and clinical research

  • Investigation of whether these biomarkers predict treatment response

5. Pharmacological Considerations:

  • Assessment of drug pharmacokinetics and pharmacodynamics across species

  • Determination of equivalent dosing regimens for translating from rat studies to human applications

  • Evaluation of potential side effects based on the receptor's wide distribution and multiple functions

6. Integration with Human Genetic Data:

  • Correlation of findings from rat models with human genetic association studies

  • Investigation of whether genetic variants that predict learning and memory in elderly patients have functional consequences in rat models

  • Development of personalized approaches based on genetic profiles

These methodological considerations can help ensure that findings from rat Tacr3 research are effectively translated to human health applications, potentially leading to new treatments for reproductive disorders, cognitive decline, and anxiety.

Data Table: Tacr3-Associated Disease Phenotypes and Their Models

Disease/PhenotypeHuman TACR3 AssociationRat Tacr3 Model CharacteristicsMethodological ApproachesReference
Hypogonadotropic hypogonadismLoss-of-function mutations in TACR3Deficient Tacr3 activity leads to lower serum testosterone levelsHormone profiling, GnRH measurement, reproductive development assessment
Delayed pubertyTACR3 mutations associated with pubertal failureSexual development increases hippocampal Tacr3 expression concurrent with testosterone elevationLongitudinal tracking of pubertal markers, hormone measurements
Anxiety disordersTacr3 deficiency linked to anxietySevere anxiety associated with dampened Tacr3 expression in ventral hippocampusBehavioral testing, testosterone treatment, receptor expression analysis
Cognitive impairmentSNP rs2765 in TACR3 predicts learning and memory in elderlyNK3R stimulation improves learning in aged ratsWater maze, object-place recognition, acetylcholine measurement
Synaptic plasticity deficitsNot directly reportedDeficient Tacr3 activity impairs LTP; defective Tacr3 causes aberrant firing patternsElectrophysiology, MEA recording, spine morphology analysis
Spine morphology alterationsNot directly reportedFunctional Tacr3 causes spine shrinkage; defective Tacr3 increases spine densityHigh-resolution microscopy, structural analysis of neurons

Advanced Considerations for Experimental Design in Tacr3 Research

Q: What are the critical factors and potential pitfalls that researchers should consider when designing experiments involving recombinant rat Tacr3?

When designing experiments with recombinant rat Tacr3, researchers should carefully consider several critical factors to ensure valid and reproducible results:

1. Expression System Selection:

  • Critical consideration: The choice between bacterial (E. coli) and mammalian expression systems significantly impacts post-translational modifications and receptor functionality

  • Potential pitfall: Bacterial systems may produce higher protein yields but potentially lack proper folding and modifications

  • Recommendation: For structural studies, bacterial expression may be sufficient; for functional studies, mammalian systems (HEK-293, COS-7) are preferred

2. Protein Tag Interference:

  • Critical consideration: N-terminal 10xHis-tags or fluorescent tags (mCherry, EGFP) may interfere with receptor function

  • Potential pitfall: Tags could alter ligand binding properties or G-protein coupling

  • Recommendation: Validate tagged constructs against untagged versions; consider C-terminal tags if N-terminal region is functionally critical

3. Signaling Pathway Specificity:

  • Critical consideration: Tacr3 activates multiple signaling pathways that can be cell-type dependent

  • Potential pitfall: Results obtained in one cell type may not translate to others

  • Recommendation: Test multiple signaling readouts (Ca²⁺, IP generation, cAMP inhibition, ERK activation) and validate findings across different cell types

4. Sex-Specific Considerations:

  • Critical consideration: Tacr3 expression fluctuates during the estrous cycle in females and increases during sexual development in males

  • Potential pitfall: Failing to account for sex differences or hormonal status could lead to inconsistent results

  • Recommendation: Include both sexes in studies; control for estrous cycle stage in females; measure relevant sex hormone levels

5. Developmental Timing:

  • Critical consideration: Tacr3 expression and function change significantly throughout development

  • Potential pitfall: Results from one developmental stage may not apply to others

  • Recommendation: Specify age of animals used (e.g., E18 to 30 days for developmental studies, 3-4 months for adult studies)

6. Regional Specificity:

  • Critical consideration: Tacr3 exhibits region-specific expression and function, particularly in the hippocampus and hypothalamus

  • Potential pitfall: Whole-brain analyses may mask region-specific effects

  • Recommendation: Include region-specific analyses; consider targeted manipulations of Tacr3 in specific brain areas

7. Mutant Receptor Characterization:

  • Critical consideration: Different mutations affect distinct aspects of receptor function (trafficking, binding, signaling)

  • Potential pitfall: Assuming all loss-of-function mutations have similar mechanisms

  • Recommendation: Characterize multiple aspects of receptor function for each mutation (whole-cell levels, plasma membrane expression, ligand binding, signaling)

8. Pharmacological Specificity:

  • Critical consideration: Tacr3 has differential affinity for tachykinins (neuromedin K > substance K > substance P)

  • Potential pitfall: Using non-specific ligands could activate multiple tachykinin receptors

  • Recommendation: Confirm specificity of pharmacological tools; use receptor-selective compounds when possible

9. Experimental Conditions Affecting Results:

  • Critical consideration: Signaling pathways can be modified by receptor recirculation rates and experimental conditions

  • Potential pitfall: Results may vary with changes in experimental protocols

  • Recommendation: Standardize protocols; report detailed methods; consider receptor dynamics in data interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.