Recombinant Rat Neuromedin-U receptor 2 (Nmur2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

Nmur2 belongs to the neuromedin U receptor family and is orthologous to human NMUR2 (neuromedin U receptor 2). Key genetic and structural features include:

AttributeHuman NMUR2Mouse Nmur2Rat Nmur2
Gene SymbolNMUR2Nmur2Nmur2
AA Length415395395
Chromosomal Location5q33.111 B1.310q22
Protein ClassClass A GPCRClass A GPCRClass A GPCR

Source: Guide to Pharmacology

The rat Nmur2 protein (UniProt ID: Q9ESQ4) shares 100% sequence identity with mouse Nmur2 and ~90% with human NMUR2, reflecting evolutionary conservation .

Functional Role in Metabolic Regulation

Nmur2 is critical for central nervous system (CNS)-mediated energy balance:

  • Food Intake and Obesity: NMUR2-deficient mice show reduced sensitivity to NMU/NMS-induced anorexia and modest resistance to diet-induced obesity .

  • Therapeutic Target: Small-molecule NMUR2 agonists (e.g., NY0116, NY0128) suppress food intake, decrease visceral adipose tissue, and reduce body weight in obese mice, validating NMUR2 as a potential anti-obesity target .

Research Applications

Recombinant Rat Nmur2 is used in:

  1. Structural Biology: Cryo-EM studies to map peptide-receptor interactions and activation mechanisms .

  2. Pharmacological Screening: Testing NMUR2 agonists/antagonists in calcium/cAMP assays to assess signaling efficacy .

  3. Obesity Models: Studying NMUR2’s role in hypothalamic circuits regulating appetite and metabolism .

Key Research Findings

  1. Peptide Selectivity: NMUR2 binds NMU and NMS with sub-nanomolar affinity but lacks selectivity between the two peptides .

  2. CNS vs. Peripheral Effects: NMUR2 mediates central NMU/NMS effects on energy expenditure, while NMUR1 (peripheral) regulates gastrointestinal function .

  3. Side Effect Profile: NMUR2-selective agonists show reduced gastrointestinal side effects compared to NMUR1-targeting drugs, enhancing therapeutic potential .

Challenges and Future Directions

  • Expression and Stability: Recombinant Nmur2 requires optimized E. coli systems to ensure proper folding and membrane integration .

  • Drug Development: Designing NMUR2-selective ligands with CNS penetration and minimal peripheral activity remains critical .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Nmur2; Tgr1; Neuromedin-U receptor 2; NMU-R2; G-protein coupled receptor TGR-1; G-protein-coupled receptor FM-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGKLENASWIHDPLMKYLNSTEEYLAHLCGPKRSDLSLPVSVAYALIFLVGVMGNLLVCM VIVRHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEIYEMWHNYPFLFGPVGCYFKTALFET VCFASILSVTTVSVERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIK FQHFPNGSSVPGSATCTVTKPMWVYNLIIQATSFLFYILPMTLISVLYYLMGLRLKRDES LEANKVAVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVEEWTESLAAVFNLI HVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVSPTCKWCHPRHRPQGPPAQKIIFLTE CHLVELTEDAGPQFPGQSSIHNTNLTTAPCAGEVP
Uniprot No.

Target Background

Function
Neuromedin-U receptor 2 (NMUR2) is a receptor for the neuropeptides neuromedin-U and neuromedin-S.
Gene References Into Functions
  1. Research demonstrates that NMUR2 signaling in the paraventricular nucleus of the hypothalamus regulates consumption and preference for high-fat foods without impacting feeding behavior associated with standard chow. PMID: 24269937
  2. Findings show that central activation of the neuromedin U2 receptor significantly reduces sleep duration and disrupts the mechanisms underlying NREM-REM sleep transitions. PMID: 21296417
  3. These results suggest that NMU modulates the function of the PVN putative parvocellular neurons and is involved in the regulation of OTergic and VPergic neurons by enhancing HCN ion channels activity via NMU-receptor 2. PMID: 15631899
  4. Expression of NMS and NMU2R genes was detected in the hypothalamus during postnatal development, with notable fluctuations in their relative levels (peaking at prepubertal stage and adulthood). PMID: 17110433
  5. Endogenous rat NmU receptors couple to both Galpha(q/11) and Galpha(i) G-proteins. Stimulation of either circular or longitudinal rat isolated colonic smooth muscle preparations with NmU resulted in robust contractions. PMID: 18180374
  6. Cultured rat calvarial osteoblast-like cells express NMUR2, the receptor isoform typical for the central nervous system. PMID: 18698496

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
The highest level is detected in the uterus. In the central nervous system, high expression levels were found in the hypothalamus and moderate levels in both the medulla oblongata and spinal cord. Expressed in the hypothalamic paraventricular nucleus (PVN

Q&A

What is the expression profile of Nmur2 in rat tissues?

Nmur2 is predominantly expressed in the central nervous system, with significant expression in the brain, making it distinct from Nmur1, which is primarily found in peripheral tissues. Rats show strong Nmur2 expression in specific brain regions associated with feeding behavior and energy homeostasis. When designing experiments, researchers should consider this region-specific expression pattern, particularly when studying centrally-mediated effects of NMU signaling, as the receptor's distribution affects the physiological relevance of experimental findings .

What expression systems are optimal for producing recombinant rat Nmur2?

For functional studies of recombinant rat Nmur2, mammalian expression systems such as HEK293 cells provide the best platform. These cells enable proper post-translational modifications, particularly glycosylation at sites like N194 in the second extracellular loop, which is important for receptor function. When establishing stable cell lines, selection with antibiotics such as G418 at 500-800 µg/ml typically yields consistent expression. Transient transfection using lipid-based reagents with 1-2 μg of plasmid DNA per 10^6 cells provides adequate expression for most functional assays . For optimal results, receptor expression should be confirmed using cell surface ELISA or immunocytochemical staining techniques.

How can I verify the functional integrity of recombinant rat Nmur2?

Functional verification of recombinant rat Nmur2 requires multiple complementary approaches. Calcium mobilization assays using fluorescent indicators (e.g., Fluo-4) can detect the immediate signaling response to NMU peptides, with EC50 values typically in the nanomolar range. Additionally, cAMP assays should be performed, as Nmur2 activation leads to decreased cAMP levels. Both signaling pathways should be assessed when characterizing novel ligands . For binding studies, competition assays using radiolabeled NMU ([125I]-NMU) can determine binding affinity. Proper glycosylation and membrane localization should be confirmed via Western blotting under non-reducing and reducing conditions to detect both monomeric (~40 kDa) and dimeric (~80 kDa) forms of the receptor .

How do Nmur2 splice variants affect experimental outcomes?

The presence of Nmur2 splice variants, particularly the truncated Nmur2S variant lacking the third exon, can significantly impact experimental outcomes in recombinant systems. This variant forms a six-transmembrane domain protein with an extracellular C-terminus that can heterodimerize with full-length Nmur2 and Nmur1. When co-expressed, Nmur2S dampens NMU signaling by blocking ligand binding capacity rather than altering receptor translocation or stability .

When working with recombinant rat Nmur2, researchers should:

  • Screen expression constructs to ensure they encode the intended full-length variant

  • Consider the possibility of endogenous splice variant expression in host cells

  • Design primers spanning exon junctions to differentiate between variants when using RT-PCR

  • Perform Western blotting under non-reducing conditions to detect potential heterodimeric complexes

The impact of Nmur2S appears to be context-dependent; in some cellular environments, it may enhance signaling through specific pathways while inhibiting others .

What are the critical considerations when designing Nmur2 dimerization studies?

Designing robust Nmur2 dimerization studies requires careful attention to several methodological factors. Nmur2 forms both homodimers and heterodimers with Nmur1 and Nmur2S through constitutive processes independent of ligand binding. When investigating these interactions:

  • Protein extraction should be performed under mild conditions without boiling to preserve dimeric complexes

  • Non-reducing SDS-PAGE conditions are essential for visualizing dimers (~80 kDa) versus monomers (~40 kDa)

  • Co-immunoprecipitation with differentially tagged receptors provides strong evidence of interaction

  • Fluorescence resonance energy transfer (FRET) techniques offer live-cell visualization of dimerization

  • Bioluminescence resonance energy transfer (BRET) provides quantitative measurement of interaction kinetics

The first five transmembrane domains appear sufficient for dimerization, suggesting these regions should be the focus of mutation studies examining dimerization interfaces . When designing fusion proteins for energy transfer studies, proper linker length and fluorophore positioning are critical to minimize false negative results due to geometrical constraints.

How do small-molecule Nmur2 agonists differ from peptide agonists in signaling outcomes?

Small-molecule and peptide Nmur2 agonists exhibit distinct signaling profiles that must be considered when designing experiments. While NMU peptides typically activate multiple downstream pathways, small-molecule agonists like NY0116 and NY0128 often display biased signaling. These compounds decrease cAMP while stimulating calcium signaling in Nmur2-expressing cells, but may differentially affect other pathways .

Key differences to consider include:

  • Pathway selectivity: Small-molecule agonists may preferentially activate specific G-protein subtypes

  • Receptor desensitization kinetics: Peptides typically induce more rapid internalization

  • Dimerization effects: Small molecules may differentially affect homo- and heterodimeric receptor complexes

  • Off-target activities: Compound 17, designed as an Nmur2 agonist, unexpectedly binds Nmur1 without activating it, acting as an Nmur1 antagonist

When evaluating novel agonists, researchers should employ multiple functional assays to comprehensively characterize signaling profiles and avoid false interpretations based on single pathway measurements .

What physiological outcomes should be measured when evaluating Nmur2-targeting compounds in vivo?

Comprehensive evaluation of Nmur2-targeting compounds in rodent models should include multiple physiological parameters beyond simple body weight measurements. Based on Nmur2 knockout studies, several key outcomes warrant assessment:

  • Food intake patterns:

    • Acute effects (0-24 hours post-administration)

    • Sustained effects (multiple days of treatment)

    • Meal frequency and size analysis

  • Energy expenditure parameters:

    • Core body temperature changes

    • Physical activity levels

    • Respiratory exchange ratio

  • Body composition measurements:

    • Visceral adipose tissue percentage (using micro-CT imaging)

    • Lean mass preservation

    • Liver fat content

  • Pain sensitivity testing:

    • Thermal hyperalgesia

    • Mechanical allodynia thresholds

  • Behavioral assessments:

    • Grooming behavior frequency and duration

    • Anxiety-related behaviors

    • Stress responses

Importantly, effects observed in wild-type animals should be validated in Nmur2-/- mice to confirm receptor specificity, as compounds may have off-target activities at other GPCRs .

What are optimal transfection conditions for recombinant rat Nmur2 expression?

Optimizing transfection conditions for recombinant rat Nmur2 requires balancing expression efficiency with functional integrity of the receptor. For transient expression in HEK293 cells, lipid-based transfection reagents typically yield better results than calcium phosphate methods, with the following protocol producing consistent outcomes:

  • Cell preparation:

    • Plate cells at 70-80% confluence 24 hours before transfection

    • Use low-passage cells (passage 5-15) maintained in DMEM with 10% FBS

  • DNA preparation:

    • Use highly purified plasmid DNA (A260/A280 ratio >1.8)

    • For co-transfection studies with multiple receptor constructs, maintain total DNA amount while adjusting ratios

  • Transfection parameters:

    • DNA:lipid ratio of 1:2.5-1:3 typically yields optimal expression

    • Perform transfection in serum-free media for 4-6 hours before replacing with complete media

    • Add sodium butyrate (5 mM) 24 hours post-transfection to enhance expression

  • Expression verification:

    • Optimal expression typically occurs 48-72 hours post-transfection

    • Confirm surface expression using non-permeabilized immunostaining

For stable cell line generation, antibiotic selection should be initiated 48 hours post-transfection, with single cell cloning to establish homogeneous populations. When co-expressing multiple constructs (e.g., Nmur2 with Nmur2S), bicistronic vectors or dual selection markers provide more consistent expression ratios than co-transfection approaches .

How can ligand binding assays be optimized for recombinant rat Nmur2?

Optimizing ligand binding assays for recombinant rat Nmur2 requires careful consideration of several technical parameters to generate reliable and reproducible data:

  • Radioligand preparation:

    • [125I]-NMU is preferred for high sensitivity

    • Maintain specific activity of >2000 Ci/mmol

    • Store aliquoted radioligand at -80°C to minimize degradation

  • Binding buffer composition:

    • 50 mM HEPES (pH 7.4)

    • 5 mM MgCl2

    • 1 mM CaCl2

    • 0.1% BSA

    • Protease inhibitor cocktail

  • Experimental conditions:

    • Use 50,000-100,000 cells per assay point

    • Conduct saturation binding with 0.01-10 nM radioligand

    • For competition assays, use fixed radioligand concentration (0.5-1 nM)

    • Include 1 μM unlabeled NMU for non-specific binding determination

  • Incubation parameters:

    • Shorter incubation times (1-4 hours) at room temperature minimize internalization effects

    • Alternatively, perform binding at 4°C for 16-18 hours for equilibrium binding

  • Separation techniques:

    • Rapid filtration through glass fiber filters (presoaked in 0.5% PEI)

    • Centrifugation through silicon oil for cell suspensions

When investigating receptor heterodimers or splice variants, include appropriate controls with individual receptor expressions to enable accurate interpretation of binding parameters. Scatchard analysis should be performed to determine if the presence of variant or partner receptors affects binding affinity (Kd) versus binding capacity (Bmax) .

What approaches resolve contradictory findings between in vitro and in vivo Nmur2 studies?

Resolving contradictions between in vitro and in vivo Nmur2 studies requires systematic investigation of several factors that may contribute to discrepancies:

  • Receptor heterodimerization effects:

    • Nmur2 forms heterodimers with Nmur1 and splice variants in vivo

    • Reconstitute these complexes in vitro by co-expression

    • Compare signaling profiles between homodimeric and heterodimeric receptor populations

  • Tissue-specific signaling modifiers:

    • Different cell types express distinct G-protein subtypes and signal transducers

    • Use primary cells from relevant tissues rather than heterologous expression systems

    • Characterize the G-protein coupling profile in target tissues versus expression systems

  • Compound metabolism and distribution:

    • Measure compound stability in plasma and tissue homogenates

    • Determine blood-brain barrier penetrance for centrally active compounds

    • Consider modified peptides with increased stability (e.g., compounds with β-amino acids or cyclic modifications)

  • Genetic background effects:

    • Use matched genetic backgrounds for in vitro and in vivo studies

    • Consider species differences when translating between rat and mouse models

    • Validate key findings in multiple genetic backgrounds

  • Developmental compensation in knockout models:

    • Compare acute pharmacological inhibition with genetic knockout results

    • Use inducible knockout models to minimize developmental adaptation

    • Examine expression of related receptors (e.g., Nmur1) in Nmur2-deficient models

This integrative approach helps identify whether discrepancies arise from methodological limitations or represent true biological complexity in Nmur2 signaling networks .

How should researchers interpret Nmur2 signaling data in the context of receptor dimerization?

Interpreting Nmur2 signaling data requires careful consideration of dimerization effects, as Nmur2 forms both homodimers and heterodimers that influence signaling outcomes:

  • Signal quantification strategies:

    • When analyzing concentration-response curves, fit data to multiple models (single-site vs. two-site)

    • Biphasic responses may indicate distinct signaling through different receptor complexes

    • Compare EC50 values between systems with defined dimer compositions

  • Dimerization-specific signaling pathways:

    • Some signaling pathways may be preferentially activated by specific dimer configurations

    • Assess multiple downstream pathways (calcium, cAMP, ERK, β-arrestin recruitment)

    • Correlation between pathway activation patterns may reveal dimerization-dependent signaling bias

  • Interpretation framework:

    Receptor ConfigurationExpected Signaling Pattern
    Nmur2 HomodimerStrong calcium mobilization, moderate cAMP inhibition
    Nmur2-Nmur1 HeterodimerAltered ligand potency, potential signaling bias
    Nmur2-Nmur2S HeterodimerReduced ligand binding, attenuated signaling
  • Validation approaches:

    • Use receptor constructs with mutations that prevent dimerization

    • Create fusion proteins that force specific dimer configurations

    • Employ bivalent ligands that target specific receptor pairs

When analyzing data from systems with undefined receptor stoichiometry, consider the possibility that observed responses represent composite signals from multiple receptor configurations. This is particularly important when evaluating novel compounds that may have different efficacies at various receptor dimer populations .

What are the latest approaches for developing selective Nmur2 agonists?

The development of selective Nmur2 agonists has evolved beyond traditional peptide modifications to incorporate novel chemical scaffolds and rational design approaches:

  • Structure-based design strategies:

    • Homology modeling of Nmur2 based on related GPCR crystal structures

    • Virtual screening of compound libraries against predicted binding pockets

    • Fragment-based approaches targeting allosteric sites

  • Peptide modification approaches:

    • Incorporation of unnatural amino acids at positions 4 and 6 of the NMU-8 sequence

    • Cyclization strategies to stabilize bioactive conformations

    • N-terminal modifications that enhance selectivity for Nmur2 over Nmur1

  • Small-molecule development:

    • The compounds NY0116 and NY0128 represent successful small-molecule Nmur2 agonists

    • These agonists decrease cAMP while stimulating calcium signaling

    • They demonstrate efficacy in decreasing high-fat diet consumption in vivo

  • Pharmacological considerations:

    • Many putative selective compounds (like compound 17) have unexpected properties

    • Thorough screening against related GPCRs is essential to confirm selectivity

    • Compounds may function as agonists at one receptor and antagonists at another

Methodological validation is critical, as exemplified by compound 17, which unexpectedly functions as an Nmur2 agonist while simultaneously acting as an Nmur1 antagonist despite initially being designed for Nmur2 selectivity .

How are Nmur2 knockout models advancing our understanding of receptor function?

Nmur2 knockout (Nmur2-/-) mouse models have provided critical insights into the receptor's physiological roles through careful phenotypic characterization:

  • Energy homeostasis phenotypes:

    • Nmur2-/- mice exhibit modest resistance to diet-induced obesity

    • This resistance is partially attributable to reduced food intake

    • These findings establish Nmur2 as a potential therapeutic target for metabolic disorders

  • Behavioral phenotypes:

    • Knockout models show altered pain responses

    • Changes in grooming behavior are observed

    • These phenotypes confirm Nmur2's role in behavioral regulation

  • Pharmacological validation:

    • Nmur2-/- mice are resistant to the anorectic effects of centrally administered NMU

    • Effects on activity and core temperature induced by NMU are absent in knockouts

    • Chronic central administration of NMU and NMS fails to reduce body weight in these mice

  • Methodological considerations:

    • Study designs must account for potential developmental compensation

    • Comparison with pharmacological inhibition provides complementary insights

    • Background strain differences may influence phenotypic manifestations

These knockout studies have established that the anorectic and weight-reducing effects of centrally administered NMU and NMS are predominantly mediated by Nmur2, supporting the development of Nmur2-selective agonists for obesity treatment .

What is the significance of Nmur2's role in visceral adipose tissue regulation?

The role of Nmur2 in regulating visceral adipose tissue (VAT) has emerged as a particularly significant aspect of its function with important implications for metabolic research:

This specific effect on VAT reduction distinguishes Nmur2-targeted approaches from many other weight loss interventions and warrants particular attention in studies evaluating Nmur2 agonists as potential therapeutics for obesity and metabolic disorders .

How can researchers overcome stability issues with recombinant Nmur2 in functional assays?

Working with recombinant Nmur2 presents several stability challenges that can be addressed through optimized handling protocols:

  • Protein stabilization strategies:

    • Include 10% glycerol in all buffers during membrane preparation

    • Add protease inhibitor cocktails containing PMSF, leupeptin, and pepstatin A

    • Maintain samples at 4°C throughout preparation and avoid freeze-thaw cycles

  • Buffer optimization:

    • Use 20 mM HEPES buffer (pH 7.4) with 150 mM NaCl for general handling

    • Include 5 mM MgCl2 and 1 mM CaCl2 to maintain receptor conformation

    • Add 0.1% BSA to prevent non-specific adsorption to surfaces

  • Storage conditions:

    • For short-term storage (1-3 days), maintain cells or membranes at 4°C

    • For medium-term storage (1-2 weeks), prepare aliquots in buffer with 10% glycerol at -20°C

    • For long-term storage, use liquid nitrogen with cryoprotectants

  • Expression system considerations:

    • Inducible expression systems can minimize receptor downregulation

    • Tetracycline-regulated systems allow controlled expression levels

    • Consider co-expression with chaperone proteins to enhance folding and stability

When working with reconstituted systems, incorporate cholesterol and specific phospholipids (PS, PI, PE at 7:1:2 ratio) into proteoliposomes to enhance receptor stability and function. For detergent solubilization, mild detergents like DDM or CHAPS at concentrations just above CMC provide optimal results .

What strategies effectively differentiate between Nmur2 and Nmur1 signaling in mixed cell populations?

Distinguishing between Nmur2 and Nmur1 signaling in mixed populations requires sophisticated experimental approaches:

  • Pharmacological differentiation:

    • Use Nmur2-selective ligands (compound 17) that act as antagonists at Nmur1

    • Apply selective concentrations of NMU (0.1-1 nM preferentially activates Nmur2)

    • Compare responses to both NMU and NMS (NMS has higher selectivity for Nmur2)

  • Genetic approaches:

    • Employ receptor-specific siRNA knockdown in native tissues

    • Use CRISPR-Cas9 to selectively modify one receptor subtype

    • Create systems with tagged receptors for selective immunoprecipitation

  • Pathway-specific analysis:

    • Nmur2 couples more efficiently to Gq/11 (calcium signaling)

    • Nmur1 shows stronger coupling to Gi (cAMP inhibition)

    • Monitor multiple pathways simultaneously to create signaling fingerprints

  • Single-cell analysis techniques:

    • Single-cell calcium imaging with subtype-specific markers

    • FRET-based sensors targeted to specific receptor populations

    • Correlative microscopy combining functional imaging with immunolabeling

These approaches can be combined in a decision tree framework, where initial pharmacological screening guides subsequent, more targeted investigations to definitively assign observed responses to specific receptor subtypes .

How should researchers address cross-reactivity issues in antibody-based detection of Nmur2?

Cross-reactivity represents a significant challenge in antibody-based detection of Nmur2, requiring rigorous validation and alternative approaches:

  • Antibody validation protocols:

    • Test antibodies on Nmur2-knockout tissues as negative controls

    • Compare staining patterns with in situ hybridization results

    • Verify specificity using overexpression systems with tagged receptors

    • Perform peptide competition assays to confirm binding specificity

  • Epitope selection strategies:

    • Target N-terminal domains that differ between Nmur1 and Nmur2

    • Avoid conserved transmembrane domains to minimize cross-reactivity

    • Consider antibodies against post-translational modifications unique to Nmur2

    • Use epitopes that distinguish between splice variants

  • Alternative detection methods:

    • Develop receptor-specific radioligands for binding studies

    • Employ quantitative PCR for transcript-level analysis

    • Use epitope-tagged recombinant receptors when possible

    • Consider proximity ligation assays for enhanced specificity

  • Recommendation framework:

    ApplicationPreferred ApproachValidation Method
    Western BlotN-terminal antibodiesKnockout tissue control
    IHC/ICCCarefully validated commercial antibodiesPeptide competition
    Flow CytometryDirectly labeled antibodiesIsotype controls
    IP StudiesHigh-affinity monoclonalsPre-clearing step

When working with novel antibodies, researchers should perform comprehensive cross-reactivity testing against related GPCRs, particularly Nmur1 and known splice variants, before employing them in critical experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.