Recombinant Rat Neuronal acetylcholine receptor subunit beta-2 (Chrnb2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please contact your local distributors.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Chrnb2; Acrb2; Neuronal acetylcholine receptor subunit beta-2; Neuronal acetylcholine receptor non-alpha-1 chain; N-alpha 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-500
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Chrnb2
Target Protein Sequence
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDI IALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGALFFREGPAAD PCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSCGLREAVDGVRFIADHMRSEDDDQS VREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYTATTFLHPDHSAPSSK
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane, permeable to sodium ions.
Gene References Into Functions

Related Research

  1. Studies demonstrate that alpha6beta2 subunit-containing nicotinic acetylcholine receptors exert opposing effects on rapid dopamine signaling in the nucleus accumbens of rats with high-versus low-response to novelty. PMID: 28666811
  2. Data indicates that while two cholinergic receptor nicotinic beta subunit 2 (beta2 subunit) mutations, F119Q and T59K, significantly enhanced the affinity of alpha-Conotoxin LvIA (LvIA), the beta2 mutation V111I considerably reduced the binding of LvIA. PMID: 25713061
  3. Artificial food colors and additives resulted in an increase in NR2B and nAChR beta2 receptor subunits in male rats and a decrease in NR2B subunits in female rats. PMID: 23429044
  4. The alpha4beta2 nicotinic cholinergic receptor is involved in behavioral impairments induced by repeated electroconvulsive seizures in rats. PMID: 23219030
  5. It is proposed that the enhanced expression of beta2 nAChR by astrocytes stimulated directly by nanomolar concentrations of Abeta(1-42) might be related to ongoing defensive or compensatory mechanisms. PMID: 15955596
  6. Mutation of F342, L343, L349, & L350 to alanine in the beta2 AChR subunit abolishes cell surface expression of mutant alpha4beta2 AChRs. There may be an obligatory role for the beta2 AChR subunit in ER export. PMID: 16014729
Database Links
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most regions of the CNS.

Q&A

What is the rat neuronal acetylcholine receptor subunit beta-2 (Chrnb2)?

Rat neuronal acetylcholine receptor subunit beta-2 (Chrnb2) is a protein subunit of nicotinic acetylcholine receptors (nAChRs), which are pentameric ligand-gated ion channels mediating fast synaptic transmission at cholinergic synapses. The protein is encoded by the Chrnb2 gene, which is homologous to the human CHRNB2 gene . Functionally, the β2 subunit combines with various α subunits (particularly α7) to form heteromeric receptors with distinct physiological and pharmacological properties compared to homomeric receptors.

In experimental settings, it's important to recognize that Chrnb2 does not typically form functional homomeric receptors but must co-assemble with α subunits. Recent research has demonstrated that β2 can co-assemble with α7 subunits to form functional heteromeric channels with properties that differ significantly from homomeric α7 receptors . When designing experiments, researchers should consider that post-translational modifications and interactions with cellular proteins may influence Chrnb2-containing receptor function.

How does Chrnb2 contribute to nicotinic receptor diversity in the rat nervous system?

Chrnb2 plays a crucial role in generating functional diversity among nicotinic receptors in the rat nervous system, particularly in the hippocampus. The co-assembly of β2 with other nAChR subunits creates receptors with distinctive functional and pharmacological properties, expanding the repertoire of cholinergic signaling mechanisms.

Evidence from rat hippocampal interneurons reveals that α7-containing nAChRs in these neurons desensitize more slowly and have different single-channel properties than what would be expected for homomeric α7 receptors . Through single-cell RT-PCR analysis, researchers have found a strong correlation between the expression of α7 and β2 subunits in individual interneurons, suggesting their co-assembly in vivo . This co-assembly likely explains the observed diversity in nAChR channel properties in native tissues.

Methodologically, researchers investigating nAChR diversity should:

  • Combine electrophysiological recordings with molecular identification of subunit expression

  • Compare properties of native receptors with those of defined subunit combinations expressed in heterologous systems

  • Use subunit-selective pharmacological tools to probe receptor composition in native tissues

What expression systems are most effective for studying recombinant rat Chrnb2?

Based on published research, several expression systems have proven effective for studying recombinant rat Chrnb2:

1. Xenopus oocytes:
This system has been successfully used for co-expression of rat α7 and β2 subunits to characterize their functional properties using two-electrode voltage clamp . Xenopus oocytes offer several advantages:

  • High protein expression levels allowing robust current recordings

  • Relatively simple maintenance and microinjection procedures

  • Stability for long-duration electrophysiological recordings

2. Mammalian cell lines:
Human embryonic kidney (TSA201) cells have been used for biochemical studies including co-immunoprecipitation experiments with α7 and β2 subunits . These cells provide:

  • Mammalian post-translational processing

  • Compatibility with various transfection methods

  • Suitability for biochemical and imaging studies

When selecting an expression system, researchers should consider their specific experimental goals. For detailed biophysical characterization, Xenopus oocytes provide robust expression and stable recordings. For studies focused on protein trafficking, processing, or interactions with mammalian cellular components, mammalian cell lines may be more appropriate, despite potentially lower expression levels.

What are the key tools needed for Chrnb2 research in recombinant systems?

Conducting effective research on recombinant rat Chrnb2 requires a comprehensive toolkit:

1. Molecular Biology Tools:

  • Verified cDNA clones for rat Chrnb2 and partner subunits (particularly α7)

  • Expression vectors appropriate for the chosen expression system

  • Site-directed mutagenesis capabilities for structure-function studies

  • PCR primers for verification and quantification of expression

2. Electrophysiological Equipment:

  • Two-electrode voltage clamp system (for Xenopus oocytes)

  • Patch-clamp equipment (for mammalian cells)

  • Fast solution exchange systems for accurate kinetic measurements

  • Temperature control systems (as kinetic parameters are temperature-dependent)

3. Pharmacological Agents:

  • Agonists: Acetylcholine, carbachol, choline (with different efficacies at various receptor combinations)

  • Antagonists: α-bungarotoxin (α7-selective), dihydro-β-erythroidine (β2-containing receptors)

  • Allosteric modulators: PNU-120596 (α7-selective)

4. Biochemical Tools:

  • Subunit-specific antibodies for co-immunoprecipitation and Western blotting

  • Detergents suitable for solubilizing intact membrane protein complexes

  • Protein purification systems

5. Analytical Software:

  • Electrophysiological data analysis programs with capabilities for:

    • Multi-exponential fitting for desensitization kinetics

    • Hill equation fitting for concentration-response relationships

    • Statistical comparison of kinetic and pharmacological parameters

How can the co-assembly of Chrnb2 with other nAChR subunits be experimentally verified?

Verifying the co-assembly of Chrnb2 with other nAChR subunits requires a multi-faceted approach combining functional and biochemical techniques:

1. Functional Electrophysiological Evidence:
The co-expression of β2 with α7 subunits in Xenopus oocytes produces receptors with distinctive functional properties that differ from homomeric α7 receptors, providing indirect evidence of co-assembly . Key parameters to measure include:

  • Desensitization kinetics (significantly slower in heteromeric α7β2 versus homomeric α7 receptors)

  • Agonist pharmacology (changes in EC50 values and efficacy)

  • Response to selective modulators

2. Biochemical Co-immunoprecipitation:
Direct molecular evidence for co-assembly can be obtained through co-immunoprecipitation experiments:

  • Transiently transfect cells (e.g., TSA201) with cDNAs encoding both subunits of interest

  • Prepare cell lysates under conditions that preserve protein-protein interactions

  • Immunoprecipitate with antibodies against one subunit

  • Detect the co-precipitated partner subunit by Western blotting

This approach has successfully demonstrated the physical association between α7 and β2 subunits in heterologous expression systems .

3. Additional Complementary Approaches:

  • Förster Resonance Energy Transfer (FRET) between fluorescently tagged subunits

  • Proximity Ligation Assay (PLA) for visualizing protein interactions in situ

  • Blue native PAGE to analyze intact receptor complexes

  • Cross-linking studies followed by mass spectrometry

When interpreting results, it's important to include appropriate controls (single subunit expressions, negative control antibodies) and to consider that detection of co-assembly in heterologous systems does not automatically prove native co-assembly in vivo.

What are the biophysical differences between homomeric α7 receptors and heteromeric α7β2 receptors?

Co-assembly of rat Chrnb2 with the α7 subunit creates heteromeric receptors with distinct biophysical properties compared to homomeric α7 receptors:

Table 1: Comparison of Biophysical Properties

ParameterHomomeric α7Heteromeric α7β2Significance
Fast desensitization time constant (τ fast)0.106 ± 0.012 s0.210 ± 0.033 sHeteromeric receptors desensitize ~2× slower
Contribution of fast component85 ± 2%68 ± 5%Heteromeric receptors have greater slow component contribution
Slow desensitization time constant (τ slow)1.11 ± 0.15 s1.27 ± 0.22 sSlight increase in slow time constant
Contribution of slow component13 ± 2%29 ± 5%Significant increase in slow component contribution
Current-voltage relationshipReferenceNo significant differenceCo-assembly does not affect voltage sensitivity

These biophysical differences are functionally significant as they alter the temporal profile of receptor activation and the duration of ion flux through the channel. The slower desensitization of heteromeric α7β2 receptors may allow for more prolonged signaling in response to acetylcholine, potentially affecting synaptic integration and neuronal excitability.

Methodologically, when characterizing these biophysical differences:

  • Use rapid application systems for accurate measurement of fast kinetic components

  • Employ bi-exponential fitting to properly resolve both fast and slow components of desensitization

  • Control temperature carefully as kinetic parameters are highly temperature-dependent

  • Compare receptors under identical recording conditions (voltage, ionic composition)

The biophysical profile of heteromeric α7β2 receptors more closely resembles that of native α7-containing receptors in rat hippocampal interneurons, supporting the hypothesis that these native receptors may be heteromeric rather than homomeric assemblies .

How do agonist pharmacology profiles differ between homomeric α7 and heteromeric α7β2 receptors?

The incorporation of the β2 subunit with α7 significantly alters the pharmacological properties of the resulting heteromeric receptors compared to homomeric α7 receptors:

1. Changes in Agonist Efficacy:

  • In homomeric α7 receptors: ACh, carbachol, and choline act as full or near-full agonists

  • In heteromeric α7β2 receptors: While ACh remains a full agonist, both carbachol and choline become only partial agonists

2. Alterations in Agonist Potency:

  • The EC50 values for ACh, carbachol, and choline significantly increase when β2 is co-expressed with α7, indicating reduced sensitivity to these agonists

These pharmacological differences provide a useful tool for distinguishing between receptor subtypes and suggest structural changes in the ligand binding domain when β2 is incorporated into the receptor complex.

Methodologically, researchers should:

  • Generate full concentration-response curves for multiple agonists

  • Use standardized protocols with proper controls for desensitization

  • Normalize responses appropriately for comparison between receptor subtypes

  • Consider using concatemeric constructs to control subunit composition and stoichiometry

The distinct pharmacological profile of heteromeric α7β2 receptors may have significant implications for drug development targeting specific nAChR subtypes, as compounds may show different efficacy or potency profiles depending on receptor composition.

What electrophysiological approaches are most suitable for characterizing Chrnb2-containing receptors?

Several electrophysiological techniques have proven effective for characterizing Chrnb2-containing receptors, each with specific applications and considerations:

1. Two-Electrode Voltage Clamp (TEVC) in Xenopus Oocytes:
This technique has been successfully used to characterize heteromeric α7β2 receptors and offers:

  • Robust expression system allowing large, measurable currents

  • Stability for extended recordings and pharmacological characterization

  • Ability to control subunit ratio by varying RNA injection amounts

  • Relatively simple implementation

Implementation considerations:

  • Use automated fast perfusion systems for accurate kinetic measurements

  • Control temperature as kinetic parameters are temperature-dependent

  • Include positive controls (e.g., homomeric α7) for comparison

2. Patch-Clamp Recording in Mammalian Expression Systems:
While not explicitly mentioned in the search results for recombinant studies, patch-clamp techniques are valuable for detailed biophysical characterization:

  • Whole-cell configuration: For macroscopic current recordings with superior temporal resolution

  • Outside-out patch configuration: For single-channel analysis and rapid solution exchange

  • Cell-attached configuration: For single-channel recording under physiological intracellular conditions

3. Protocol Design Considerations:

  • For desensitization studies:

    • Apply agonist for sufficient duration to reach steady-state desensitization

    • Allow complete recovery between applications (particularly important for α7-containing receptors)

    • Use bi-exponential fitting to capture both fast and slow components

  • For pharmacological characterization:

    • Generate complete concentration-response curves

    • Use both EC20 and saturating concentrations to assess both potency and efficacy

    • Test multiple agonists to create a comprehensive pharmacological profile

  • For single-channel analysis:

    • Use low agonist concentrations to observe isolated channel openings

    • Record at different holding potentials to determine conductance and rectification properties

    • Analyze dwell-time distributions to extract kinetic information

The choice of technique should be guided by the specific research question, with TEVC in oocytes being particularly suited for initial pharmacological characterization and comparison of different subunit combinations, while patch-clamp in mammalian cells offers superior resolution for detailed kinetic analysis.

What molecular biology approaches can be used to control the stoichiometry of recombinant Chrnb2-containing receptors?

Controlling the stoichiometry of recombinant Chrnb2-containing receptors is crucial for studying specific receptor subtypes with defined subunit compositions. Several molecular biology approaches can help achieve this:

1. RNA/DNA Ratio Manipulation:
The search results describe experiments in which different ratios of α7 and β2 subunit RNA were injected into Xenopus oocytes:

  • Equal amounts (25 ng each) of α7 and β2 subunit RNAs

  • Increased ratio (25 ng α7 and 75 ng β2) to enhance β2 incorporation

While this approach is straightforward, it doesn't guarantee precise stoichiometry control as the relationship between RNA/DNA ratio and assembled receptor stoichiometry is not always linear.

2. Linked Subunit Concatemers:
This approach involves creating genetic constructs where multiple subunits are linked by short peptide sequences:

  • Design constructs with defined subunit order (e.g., β2-α7-β2-α7-α7)

  • Express the concatemeric construct in appropriate cells

  • Verify proper assembly and membrane trafficking

  • Confirm functionality through electrophysiological recording

Advantages include:

  • Precise control over subunit positioning within the pentamer

  • Ability to create "forced" stoichiometries for comparative studies

  • Capacity to introduce mutations into specific positions within the pentamer

3. Reporter Tags and Fluorescence-Based Approaches:

  • Introduce fluorescent protein tags to different subunits

  • Use FRET or fluorescence intensity ratios to estimate stoichiometry

  • Apply single-molecule subunit counting techniques

4. Biophysical and Pharmacological Validation:
Regardless of the molecular approach used, functional validation is essential:

  • Use subunit-specific pharmacological agents to verify incorporation

  • Compare biophysical properties with theoretically predicted properties

  • Employ biochemical approaches (e.g., crosslinking) to confirm stoichiometry

When applying these techniques to Chrnb2-containing receptors, researchers should consider:

  • Potential effects of modifications on receptor assembly and function

  • The need for multiple complementary approaches to confirm stoichiometry

  • The possibility that different expression systems may yield different preferred stoichiometries

Properly controlled receptor stoichiometry enables more precise structure-function studies and better comparison with native receptors, which is particularly important given the observed diversity of nAChR subtypes in the rat nervous system .

How do native neuronal Chrnb2-containing receptors differ from recombinant receptors?

Understanding the differences between native and recombinant Chrnb2-containing receptors is crucial for translating findings from expression systems to physiological contexts. Several key differences have been identified:

1. Desensitization Kinetics:

  • Native α7-containing nAChRs in rat hippocampal interneurons desensitize more slowly than recombinant homomeric α7 receptors expressed in heterologous systems

  • This slower desensitization of native receptors more closely resembles that of heteromeric α7β2 receptors than homomeric α7 receptors

2. Single-Channel Properties:

  • Native α7-containing receptors in rat hippocampal interneurons have a smaller single-channel conductance compared to recombinant homomeric α7 receptors

  • This difference suggests a distinct subunit composition or arrangement in native receptors

3. Subunit Composition:

  • Strong correlation between expression of α7 and β2 subunits in individual rat hippocampal interneurons suggests co-assembly in vivo

  • Native receptors may contain additional subunits or accessory proteins not present in simplified recombinant systems

4. Functional Diversity:

  • Native neuronal nAChRs show greater functional diversity than can be explained by homomeric assemblies

  • This diversity likely reflects various subunit combinations, post-translational modifications, and interactions with neuronal proteins

Methodological approaches to compare native and recombinant receptors include:

  • Patch-clamp recording from identified neurons followed by single-cell RT-PCR to correlate functional properties with subunit expression

  • Comparison of pharmacological profiles using identical protocols and conditions

  • Analysis of single-channel properties to identify conductance states and kinetic signatures

  • Manipulation of native receptor subunit expression through RNA interference or genetic approaches

The observation that heteromeric α7β2 receptors expressed in Xenopus oocytes more closely resemble native α7-containing receptors than homomeric α7 receptors provides strong support for the hypothesis that α7 and β2 subunits co-assemble in vivo , highlighting the importance of studying heteromeric receptor combinations.

What are the current challenges and limitations in studying recombinant Chrnb2 function?

Despite significant advances in understanding Chrnb2-containing receptors, several challenges and limitations affect research in this field:

1. Stoichiometry Control and Verification:

  • It remains difficult to precisely control and verify the stoichiometry of assembled receptors in heterologous systems

  • When multiple subunits are co-expressed, a mixture of receptor subtypes may form, complicating interpretation

  • Methodological solution: Use of linked subunit concatemers or reporter-tagged subunits can help address this issue, though these approaches have their own limitations

2. Distinguishing Receptor Populations:

  • When multiple receptor subtypes coexist (e.g., homomeric α7 and heteromeric α7β2), isolating the contribution of specific subtypes is challenging

  • Methodological solution: Develop more selective pharmacological tools or use expression systems with knockout/knockdown of specific subunits

3. Temporal Resolution Limitations:

  • The very fast activation and desensitization kinetics of nAChRs approach the limits of solution exchange systems

  • Methodological solution: Use ultrafast perfusion systems, temperature control, and appropriate curve-fitting models to extract kinetic parameters

4. Translation to Native Context:

  • Heterologous expression systems lack the neuronal environment that may influence receptor function in vivo

  • Native neurons express multiple nAChR subtypes simultaneously, making isolation of Chrnb2-specific effects difficult

  • Methodological solution: Combine heterologous expression with studies in native neurons, using genetic or pharmacological tools to isolate specific receptor subtypes

5. Antibody Specificity Issues:

  • Limitations in antibody specificity and sensitivity can affect biochemical studies of Chrnb2-containing receptors

  • Methodological solution: Validate antibodies using knockout/knockdown controls and employ multiple independent antibodies

6. Integration with Cellular Signaling:

  • Understanding how Chrnb2-containing receptors integrate with downstream signaling pathways remains challenging

  • Methodological solution: Combine electrophysiology with calcium imaging, biochemical assays, and computational modeling

Addressing these challenges requires multidisciplinary approaches combining molecular biology, electrophysiology, biochemistry, and advanced imaging techniques. The field continues to benefit from technological advances such as cryo-electron microscopy for structural studies, improved genetic tools, and more selective pharmacological agents.

How can site-directed mutagenesis of Chrnb2 advance our understanding of channel function?

Site-directed mutagenesis provides a powerful approach to investigate structure-function relationships in Chrnb2-containing receptors. The search results mention one specific example where a mutation in the β2 subunit (leucine to cysteine in the pore region) dramatically slowed receptor desensitization when co-expressed with α7 . This illustrates how targeted mutations can reveal functional domains and mechanisms.

Key applications of site-directed mutagenesis for Chrnb2 research include:

1. Investigating Subunit Interfaces and Assembly:

  • Mutate residues at interfaces between β2 and partner subunits

  • Identify critical residues for heteromeric assembly

  • Methodological approach: Combine mutagenesis with co-immunoprecipitation or functional studies to assess assembly efficiency

2. Examining Pore Structure and Ion Permeation:

  • Mutate channel-lining residues in TM2 domain

  • Alter charged residues to modify ion selectivity or conductance

  • Introduce cysteine residues for subsequent modification with MTS reagents

  • Methodological approach: Measure current-voltage relationships and single-channel conductance before and after mutation

3. Studying Agonist Binding and Gating Mechanisms:

  • Mutate residues in the extracellular domain that contribute to binding sites

  • Modify residues in coupling regions between binding site and channel gate

  • Methodological approach: Construct concentration-response curves for various agonists to determine changes in EC50 and efficacy

4. Exploring Desensitization Mechanisms:

  • Target residues in domains known to influence desensitization kinetics

  • Create mutations analogous to those that affect desensitization in other nAChR subunits

  • Methodological approach: Apply prolonged agonist applications and analyze desensitization time courses

5. Identifying Sites for Allosteric Modulation:

  • Mutate residues in transmembrane domains or subunit interfaces

  • Test the effect of known allosteric modulators on wild-type versus mutant receptors

  • Methodological approach: Compare concentration-response relationships for agonists in the presence and absence of modulators

When designing mutagenesis studies, researchers should:

  • Use evolutionary conservation analysis to prioritize residues

  • Consider creating multiple mutations to map functional domains

  • Include appropriate controls (wild-type receptors, non-functional mutations)

  • Verify surface expression of mutant receptors

  • Apply complementary structural and functional approaches

The power of this approach is illustrated by the finding that a single point mutation in the β2 subunit can significantly alter the desensitization properties of heteromeric α7β2 receptors , demonstrating how targeted mutations can provide insight into both receptor structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.