Recombinant Rat Neuronal acetylcholine receptor subunit beta-4 (Chrnb4)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Structure:

  • Encoded by the Chrnb4 gene (NCBI Gene ID: 2351 ), this β4 subunit contains four transmembrane domains (TMDs) and an extracellular N-terminal ligand-binding region .

  • Forms heteropentameric ligand-gated ion channels with α subunits (e.g., α2, α3, α4) .

Key Properties:

ParameterValue/Detail
Molecular Weight~56 kDa (predicted); 48–60 kDa (observed via SDS-PAGE)
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE verified)
Post-Translational ModificationsGlycosylation sites in the extracellular domain (shared with human β4)

Research Applications

Recombinant β4 subunits enable mechanistic studies of nAChR assembly, pharmacology, and disease associations:

  • Ligand Binding Studies: β4-containing nAChRs exhibit distinct affinities for nicotine, cytisine, and epibatidine compared to β2-containing receptors .

  • Functional Assays: Used in electrophysiology (e.g., patch-clamp) to analyze ion channel kinetics and desensitization properties .

  • Disease Modeling: Linked to nicotine dependence, anxiety, and frontotemporal dementia .

Table 1: Key Research Insights

Study FocusMethodologyKey ResultsSource
Nicotine ResponseHeterologous expression in SH-EP1 cellsα4β4-nAChR desensitizes faster than α4β2 and shows higher EC₅₀ for nicotine
Behavioral PhenotypingChrnb4 KO miceIncreased anxiety-like behavior in elevated plus-maze assays
Epilepsy LinkClinical variant analysisβ4 mutations alter thalamocortical circuit excitability
Toxin InteractionConotoxin bindingβ4 subunits in α3β4-nAChR mediate sensitivity to α-conotoxin BuIA

Mechanistic Insights:

  • β4 subunits confer resistance to nicotine-induced seizures in rodent models .

  • Co-expression with α4 subunits modulates anxiety-related behaviors, independent of β2 subunits .

Table 2: Production and Validation Data (Representative Product)

ParameterDetail
Expression SystemE. coli (full-length protein, 21–495 aa)
TagN-terminal His-tag
Reconstitution BufferTris/PBS + 6% trehalose (pH 8.0)
Validated ApplicationsWestern blot, ELISA, Immunohistochemistry
Cross-ReactivityHuman, mouse, rat

Pathophysiological Relevance

  • Nicotine Dependence: β4-containing nAChRs in the habenulo-interpeduncular pathway drive nicotine withdrawal symptoms .

  • Neurological Disorders: Altered β4 expression correlates with frontotemporal dementia and autosomal dominant epilepsy .

Limitations and Future Directions

  • Species Specificity: Rat β4 (UniProt: P12392) shares 92% identity with human β4 (P30926), but ligand responses may differ .

  • Therapeutic Targeting: Developing β4-selective modulators remains challenging due to structural homology with other nAChR subunits .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your requested tag.
Synonyms
Chrnb4; Acrb4; Neuronal acetylcholine receptor subunit beta-4; Neuronal acetylcholine receptor non-alpha-2 chain; N-alpha 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-495
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Chrnb4
Target Protein Sequence
RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWL KQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSI QWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHH RSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPHPSQLHLATADTAATSALGPT SPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSSGRFREDLQEALEGVSFIAQH LESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGLFLPPLFQIHAPSKDS
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. Four genes exhibited significant downregulation in the PFC [prefrontal cortex] of SHR [spontaneously hypertensive rat] compared to Wistar rats (Gad2, Chrnb4, Slc5a7, and Qrfpr), with no downregulation observed in the nucleus accumbens. PMID: 25041985
  2. alpha6beta4* nAChRs are among the subtypes expressed by dorsal root ganglion neurons. Notably, this study represents the first demonstration of alpha6beta4* in neurons outside the CNS. PMID: 22024738
  3. Loop 9 plays distinct roles in the function of homomeric and heteromeric receptors. PMID: 20043866
  4. Immunocytochemistry revealed that most chromaffin cells are positive for beta4 proteins. This suggests that the most commonly encountered receptors in rat chromaffin cells likely include alpha3beta4, alpha3beta2, with the addition of alpha5 subunits. PMID: 12814364
  5. Only residues belonging to two beta2 segments, 74-89 and 106-115, confer upregulation to beta4, primarily by reducing the amount of binding sites in the absence of nicotine. Notably, the beta4 microdomain is sufficient to impart a beta4-like upregulation to beta2. PMID: 14764595
Database Links

KEGG: rno:25103

STRING: 10116.ENSRNOP00000051052

UniGene: Rn.9695

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In the brain, it is detected in the medial habenula. In the peripheral nervous system, it is found at least in the adrenal gland.

Q&A

What is the functional role of CHRNB4 in neuronal signaling?

CHRNB4 is a beta subunit of neuronal nicotinic acetylcholine receptors (nAChRs) that forms pentameric ligand-gated ion channels with alpha subunits (typically α3) . After binding acetylcholine, the receptor undergoes an extensive conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane . This channel facilitates cation movement, particularly sodium and calcium ions, resulting in membrane depolarization and subsequent neuronal activation . CHRNB4 is particularly abundant in autonomic ganglia, where it forms acetylcholine binding sites and ion channels, predominantly with α3 or α3 and α5 subunits .

How does recombinant rat CHRNB4 differ structurally from human CHRNB4?

While the search results don't provide direct structural comparison between rat and human CHRNB4, evolutionary conservation analysis indicates high sequence homology between these orthologs, particularly in functional domains. Human CHRNB4 contains an extracellular amino terminus and four transmembrane domains, with the protein fragment in the 68-177 amino acid range being particularly important for function . The rat CHRNB4 maintains similar domain organization, with both species' proteins belonging to the ligand-gated ion channel family (TC 1.A.9) . The transmembrane regions and ligand-binding domains show the highest conservation, while cytoplasmic loops may exhibit greater sequence divergence, potentially affecting interactions with intracellular signaling molecules.

What expression systems are most effective for producing functional recombinant rat CHRNB4?

The optimal expression systems for recombinant rat CHRNB4 depend on the research application. For structural studies and biochemical assays, HEK293 cells have proven effective as they provide mammalian post-translational modifications essential for proper folding and function . For high-throughput applications or when studying protein-protein interactions, wheat germ cell-free expression systems have demonstrated success, as evidenced by their use with human CHRNB4 . The table below summarizes expression system considerations:

Expression SystemAdvantagesLimitationsSuitable Applications
HEK293 cellsMammalian post-translational modifications; proper foldingLower yield; more resource-intensiveFunctional studies; co-immunoprecipitation
Wheat germHigher yield; fewer contaminating proteinsLimited post-translational modificationsELISA; Western blotting; protein-protein interaction studies
E. coliHighest yield; cost-effectiveLacks proper folding for transmembrane proteinsProduction of soluble domains for antibody generation

What quality control methods should be used to validate recombinant rat CHRNB4?

Validation of recombinant rat CHRNB4 requires multiple orthogonal techniques. SDS-PAGE with Coomassie staining confirms protein size and purity, as demonstrated with human CHRNB4 preparations . Western blotting using specific antibodies verifies protein identity. Circular dichroism spectroscopy assesses secondary structure integrity, particularly important for transmembrane proteins. For functional validation, ligand-binding assays using radiolabeled acetylcholine or nicotine can confirm biological activity. Mass spectrometry analysis provides definitive identification and can detect post-translational modifications. For applications requiring native conformation, such as drug screening, patch-clamp electrophysiology with heterologous expression systems can verify channel formation and conductance.

How can CRISPR/Cas9 gene editing be optimized for studying CHRNB4 function in neuronal models?

CRISPR/Cas9 gene editing has emerged as a powerful tool for studying CHRNB4 function. Based on successful applications in HNSCC cells, several optimization strategies are recommended for neuronal models . First, design multiple sgRNAs targeting different exons of CHRNB4, with emphasis on highly conserved functional domains. In published studies, sgRNA design using MIT CRISPR Design platform yielded editing efficiencies of 88.6-94% . For delivery into neuronal cells, lentiviral vectors (such as lentiCRISPR v2) have demonstrated superior transfection efficiency compared to plasmid-based methods .

Editing verification should employ a multi-modal approach: Western blotting to confirm protein reduction, Sanger sequencing to identify indel patterns, and Tracking of Indels by Decomposition (TIDE) analysis to quantify editing efficiency . In previous studies of CHRNB4, TIDE analysis revealed single-base insertions were the predominant editing outcome (49.5-58.4%) . For functional validation, electrophysiological recordings comparing wild-type and edited neurons can directly measure changes in receptor conductance, as demonstrated in β4 knockout studies showing attenuated responses to nicotinic agonists .

What are the most sensitive assays for measuring the pharmacological properties of recombinant rat CHRNB4-containing receptors?

The pharmacological characterization of CHRNB4-containing receptors requires specialized techniques that measure both ligand binding and functional responses. Radioligand binding assays using [³H]-epibatidine or [¹²⁵I]-α-bungarotoxin provide quantitative binding affinity data (Kd values) but don't reveal functional consequences . For functional measurements, patch-clamp electrophysiology remains the gold standard, allowing real-time recording of channel opening in response to agonists like acetylcholine, nicotine, cytisine, or epibatidine .

Calcium imaging using fluorescent indicators (Fura-2, Fluo-4) offers higher throughput for screening multiple compounds. When comparing pharmacological properties of rat vs. human CHRNB4-containing receptors, consider the following parameters:

ParameterMeasurement TechniqueTypical Values for α3β4 ReceptorsNotes
EC₅₀ for AChPatch-clamp100-200 μMSpecies-dependent variations exist
EC₅₀ for NicotinePatch-clamp10-30 μMHigher affinity than ACh
Desensitization RatePatch-clampτ = 5-15sImportant for chronic exposure studies
Single Channel ConductanceSingle-channel recording30-40 pSRequires specialized equipment
Ca²⁺ PermeabilityReversal potential measurementPCa/PNa = 1.5-2.5Critical for Ca²⁺-dependent signaling

How does phosphorylation status affect CHRNB4 function, and what methods best characterize these post-translational modifications?

Phosphorylation of CHRNB4 significantly impacts receptor function by altering channel gating properties, receptor trafficking, and sensitivity to agonists. While not directly mentioned in the search results, research on related nicotinic receptor subunits suggests that protein kinases (PKA, PKC, and tyrosine kinases) can phosphorylate cytoplasmic loops between transmembrane domains, affecting receptor desensitization rates and surface expression.

To characterize CHRNB4 phosphorylation, a multi-technique approach is recommended. Mass spectrometry, particularly phosphoproteomics using titanium dioxide enrichment followed by LC-MS/MS, can identify specific phosphorylation sites. Phospho-specific antibodies, when available, enable Western blotting to quantify phosphorylation levels under different conditions. For functional impact assessment, patch-clamp electrophysiology comparing wild-type with phosphomimetic (S/T→D) or phosphodeficient (S/T→A) mutants reveals how phosphorylation affects channel kinetics. Alternatively, treatments with kinase activators/inhibitors followed by functional assays can indirectly assess phosphorylation effects on native receptors.

What are the challenges in producing recombinant CHRNB4 that retains native conformation, and how can they be overcome?

Producing recombinant CHRNB4 that maintains native conformation presents several challenges due to its transmembrane nature and requirement for proper assembly with alpha subunits. The primary difficulties include proper membrane insertion, correct disulfide bond formation, and assembly with appropriate partner subunits to form functional pentamers .

To overcome these challenges, several strategies have proven effective:

  • Co-expression with partner subunits (particularly α3) in mammalian expression systems to promote proper assembly .

  • Inclusion of chaperone proteins that facilitate folding of transmembrane proteins.

  • Use of detergent screens to identify conditions that maintain native conformation during solubilization.

  • Implementation of stabilizing mutations identified through alanine-scanning mutagenesis.

  • Expression of the extracellular domain only for structural studies, as this region contains the ligand-binding site .

For verification of native conformation, binding assays with conformation-sensitive ligands or antibodies provide crucial validation. Thermal stability assays (thermofluor) help identify buffer conditions that maximize protein stability. Negative-stain electron microscopy offers visual confirmation of pentameric assembly.

How can researchers effectively design experiments to study CHRNB4 involvement in nicotine dependence models?

Designing robust experiments to investigate CHRNB4's role in nicotine dependence requires careful consideration of model systems and outcome measures. Based on known associations between CHRNB4 variants and nicotine dependence , several experimental approaches are recommended:

For in vitro studies, compare nicotine-induced calcium influx or current responses in neurons expressing wild-type versus mutant CHRNB4 variants associated with dependence. Use patch-clamp electrophysiology to measure acute and chronic effects of nicotine on receptor desensitization, which relates to tolerance development.

For in vivo studies, utilize transgenic approaches (knockout, knockin, or conditional expression) to manipulate CHRNB4 expression in specific neural circuits. The interpeduncular nucleus should be a primary target, given its high expression of CHRNB4 . Behavioral assays should include self-administration paradigms, conditioned place preference, and withdrawal symptom assessment. When designing these models, consider the following factors:

Experimental FactorRecommended ApproachRationale
Animal Modelβ4 knockout mice; humanized knockin mice with risk variantsDirect comparison of wild-type vs. altered CHRNB4 function
Circuit SpecificityCre-dependent viral vectors targeting interpeduncular nucleusHigh CHRNB4 expression in this region
Nicotine ExposureSelf-administration paradigm with progressive ratioMore translational than forced exposure
Outcome MeasuresCombination of molecular (receptor expression), electrophysiological, and behavioral assessmentsMulti-level analysis reveals mechanisms
Statistical DesignPower analysis based on effect sizes from β4 knockout studies Ensures sufficient sample size for meaningful results

What troubleshooting strategies address common issues when working with recombinant CHRNB4 in binding assays?

Researchers frequently encounter challenges when using recombinant CHRNB4 in binding assays, including high background, poor signal-to-noise ratio, and variability between preparations. Systematic troubleshooting approaches can address these issues:

For high non-specific binding, optimize buffer conditions by testing different detergents (CHAPS, DDM, or digitonin) at varying concentrations. Include competitors like cold ligands at 100-1000× excess to define non-specific binding precisely. When signal intensity is insufficient, ensure that CHRNB4 is co-expressed with appropriate alpha subunits to form complete binding sites . Consider increasing protein concentration or using signal amplification methods such as europium-labeled secondary antibodies.

If batch-to-batch variability occurs, implement rigorous quality control measures including:

  • Western blotting to confirm expression levels

  • Circular dichroism to verify secondary structure

  • Standard curve generation with known positive controls

  • Use of internal standards across experiments

For pre-coupled magnetic beads applications, optimize protein:bead ratio and coupling conditions, as insufficient coupling results in low signal while overcrowding causes steric hindrance . Always include both positive controls (known binding partners) and negative controls (non-related proteins of similar size) to validate assay specificity.

How can contradictory findings between knockout studies and pharmacological inhibition of CHRNB4 be reconciled?

  • Developmental compensation: In knockout models, compensatory upregulation of other nAChR subunits (particularly β2) may occur during development, masking the full impact of β4 loss . Time-controlled conditional knockouts can address this issue.

  • Selectivity limitations: Many pharmacological agents lack absolute selectivity for β4-containing receptors, affecting other receptor subtypes to varying degrees. Validation with multiple structurally distinct antagonists helps confirm target specificity.

  • Kinetic differences: Acute pharmacological blockade versus chronic genetic absence represents fundamentally different temporal perturbations, potentially activating different adaptive mechanisms.

  • Partial versus complete inhibition: Pharmacological agents rarely achieve 100% receptor occupancy, while genetic knockouts eliminate the protein entirely.

To reconcile such contradictions, implement parallel experiments using both approaches, ideally in the same experimental system. Include dose-response studies with pharmacological agents and complementary gain-of-function experiments (e.g., rescue of knockout phenotype with viral-mediated re-expression). Electrophysiological recordings comparing knockouts with antagonist-treated wild-type samples can directly measure functional differences at the cellular level.

What role does CHRNB4 play in cancer progression, and how can recombinant proteins facilitate this research?

Recent evidence has implicated CHRNB4 in cancer progression, particularly in smoking-related cancers. In head and neck squamous cell carcinoma (HNSCC), CHRNB4 expression increases following treatment with NNK (a tobacco-specific carcinogen) . When CHRNB4 was gene-edited using CRISPR/Cas9 in HNSCC cell lines, both migration and invasion abilities were significantly reduced, suggesting CHRNB4 plays an essential role in cancer development and metastasis .

Recombinant CHRNB4 proteins can facilitate cancer research through multiple applications:

  • Target validation studies: Purified recombinant CHRNB4 can be used in binding assays to screen potential inhibitors that might block its tumor-promoting functions .

  • Signaling pathway elucidation: CHRNB4 likely promotes cancer progression through specific signaling cascades. Recombinant proteins with site-specific modifications or mutations can help identify critical regions required for these functions.

  • Biomarker development: CHRNB4 has potential as a diagnostic and prognostic biomarker, particularly in smoking-related cancers . Recombinant proteins serve as standards for developing detection assays.

The table below summarizes findings on CHRNB4's role in cancer based on published studies:

Cancer TypeCHRNB4 RoleExperimental EvidenceReference
HNSCCPromotes cell migration and invasionCRISPR/Cas9 knockout reduced migration by 1.45-1.58× and invasion by 2.71-5.53×
Lung CancerAssociated with susceptibilityGenetic association studies
Oral Cavity CancerPotential involvementOrtholog studies

How can single-molecule techniques advance our understanding of CHRNB4-containing receptor dynamics?

Single-molecule techniques offer unprecedented insights into CHRNB4-containing receptor conformational dynamics, subunit stoichiometry, and assembly kinetics that are obscured in ensemble measurements. While not directly addressed in the search results, these approaches represent a frontier in nAChR research.

Single-molecule FRET (smFRET) with strategically placed fluorophores on recombinant CHRNB4 and partner subunits can track conformational changes during gating in real-time. This technique requires engineering of cysteine residues for site-specific labeling, careful selection of fluorophore pairs, and optimization of protein reconstitution in lipid environments. Single-particle tracking using quantum dot-labeled receptors in live neurons reveals diffusion dynamics and clustering behavior in response to agonists or antagonists.

For stoichiometry determination, single-molecule photobleaching analysis can definitively resolve the number of each subunit type within individual receptors, clarifying whether pentamers contain one or two β4 subunits. Super-resolution microscopy techniques (STORM, PALM) using recombinant CHRNB4 tagged with photoconvertible fluorescent proteins enable visualization of nanoscale receptor organization at synapses with ~20 nm resolution, far beyond the diffraction limit of conventional microscopy.

What are the latest approaches for investigating CHRNB4 interactions with intracellular signaling molecules?

The interaction between CHRNB4 and intracellular signaling molecules represents a critical aspect of nAChR function beyond ion conduction. Advanced methodologies now enable detailed characterization of these protein-protein interactions and their functional consequences.

Proximity-based labeling techniques such as BioID or APEX2 are particularly powerful when fused to recombinant CHRNB4. These systems enable identification of transient interacting partners in living cells through biotinylation of nearby proteins, followed by streptavidin pulldown and mass spectrometry. This approach has advantages over traditional co-immunoprecipitation by capturing weak or transient interactions that occur in the native cellular environment.

For direct visualization of protein interactions, bimolecular fluorescence complementation (BiFC) or FRET-based sensors using recombinant CHRNB4 fused to fluorescent protein fragments can confirm specific interactions and their subcellular localization. Protein microarrays spotted with recombinant CHRNB4 intracellular domains facilitate high-throughput screening of potential binding partners from cellular lysates.

Functional validation of identified interactions can be achieved through phosphoproteomics comparing wild-type cells with those expressing CHRNB4 variants that disrupt specific protein-protein interactions. This approach reveals downstream signaling consequences beyond electrophysiological changes. Additionally, recombinant CHRNB4 cytoplasmic domain peptides can be used as competitive inhibitors to disrupt specific interactions in cellular systems, providing temporal control not possible with genetic approaches.

What statistical approaches are most appropriate for analyzing dose-response data from CHRNB4-expressing systems?

Analyzing dose-response data from CHRNB4-expressing systems requires statistical approaches that account for the complex pharmacology of nicotinic receptors, including multiple conductance states, desensitization, and potential cooperativity in ligand binding. Non-linear regression using the Hill equation is the foundation for analyzing such data, but several considerations can enhance analysis quality.

For basic concentration-response relationships, four-parameter logistic regression (4PL) modeling provides EC₅₀/IC₅₀ values, Hill coefficients, and maximum/minimum responses. When comparing wild-type CHRNB4 with mutant variants or across species, statistical tests for curve parameters (F-test) rather than individual data points provide more meaningful comparisons. For complex responses showing biphasic characteristics (common with desensitizing receptors), biphasic dose-response models or operational models of agonism better capture the underlying biology.

When analyzing electrophysiological recordings, which often show high variability between cells, hierarchical or mixed-effects models that account for both within-cell and between-cell variability improve statistical power. Time-dependent responses, particularly relevant for desensitization studies, require specialized analysis methods such as exponential fitting of current decay or mathematical modeling of state transitions.

For all analyses, bootstrapping or permutation tests provide robust confidence intervals that don't rely on assumptions of normality. Bayesian approaches, while computationally intensive, offer advantages when integrating prior knowledge about CHRNB4 pharmacology into the analysis.

How should researchers interpret contradictory data between in vitro and in vivo studies of CHRNB4 function?

Contradictions between in vitro and in vivo findings on CHRNB4 function are common and require systematic interpretation strategies. Such discrepancies were observed in studies comparing β4 knockout mice with cell-based models . Several factors contribute to these differences and should be considered during interpretation:

  • Compositional differences: In vitro systems often express defined receptor compositions (e.g., α3β4), while in vivo receptors may contain additional subunits (α5, α3β4α5) that alter function . Receptor stoichiometry may also differ between systems.

  • Compensatory mechanisms: In vivo knockout models often exhibit compensatory upregulation of other nicotinic receptor subunits that mask phenotypes, as suggested by altered hexamethonium sensitivity in β4 knockout mice .

  • Cellular context: Accessory proteins and post-translational modifications present in vivo may be absent in recombinant systems, affecting receptor function.

  • Exposure kinetics: In vivo drug exposure involves complex pharmacokinetics not replicated in vitro.

To reconcile contradictory data:

  • Develop increasingly complex in vitro models that better approximate in vivo conditions (e.g., co-culture systems, organoids).

  • Use viral-mediated knockdown in adult animals to minimize developmental compensation.

  • Perform parallel studies using the same ligands at comparable effective concentrations.

  • Consider the specific endpoint measured—electrophysiological parameters may show differences not reflected in behavioral outcomes.

  • Implement genetic rescue experiments (re-expressing CHRNB4 in knockout backgrounds) to confirm phenotype specificity.

What are the most promising approaches for targeting CHRNB4-containing receptors in smoking cessation therapies?

The development of smoking cessation therapies targeting CHRNB4-containing receptors represents a promising frontier, given the established associations between CHRNB4 variants and nicotine dependence . Several strategic approaches warrant investigation:

  • Selective partial agonists: Compounds that selectively activate α3β4 receptors with moderate efficacy could reduce craving while minimizing side effects. Unlike varenicline, which primarily targets α4β2 receptors, β4-selective compounds might address different aspects of dependence.

  • Positive allosteric modulators (PAMs): These compounds bind to sites distinct from the acetylcholine binding site and enhance receptor function without directly activating the receptor. β4-selective PAMs could enhance the effects of endogenous acetylcholine, potentially reducing withdrawal symptoms while avoiding receptor desensitization.

  • Receptor trafficking modulators: Compounds that affect surface expression of β4-containing receptors could provide a novel therapeutic approach. Based on CRISPR/Cas9 studies showing reduced cell migration and invasion in CHRNB4-edited cells, modulating receptor levels rather than function might offer therapeutic benefits .

  • Gene therapy approaches: For individuals with genetic variants conferring high addiction risk, RNA interference or CRISPR-based approaches delivered to specific brain regions could modulate CHRNB4 expression. The interpeduncular nucleus represents a prime target given its high CHRNB4 expression .

  • Combination approaches: Therapies targeting β4-containing receptors could complement existing treatments that primarily affect β2-containing receptors, potentially addressing multiple aspects of nicotine dependence simultaneously.

How might advances in cryo-EM technology impact structural studies of CHRNB4-containing receptors?

Recent advances in cryo-electron microscopy (cryo-EM) technology are revolutionizing structural biology of membrane proteins, with significant implications for CHRNB4-containing receptor research. While not directly addressed in the search results, these technological developments offer unprecedented opportunities to resolve structural details that have eluded traditional approaches.

The latest generation of cryo-EM instruments with electron-counting detectors and energy filters can achieve sub-2Å resolution for membrane proteins, potentially revealing precise details of the acetylcholine binding site at the interface between alpha and beta subunits . This resolution enables visualization of bound ligands, water molecules, and ion coordination sites critical for understanding channel function. For recombinant rat CHRNB4, optimization of protein expression and purification for cryo-EM studies would require:

  • High-yield expression systems (likely mammalian cells)

  • Co-expression with appropriate alpha subunits to form stable pentamers

  • Careful detergent screening or nanodiscs for membrane mimetics

  • Ligand binding to stabilize specific conformational states

Time-resolved cryo-EM methods, while still emerging, offer the exciting prospect of capturing CHRNB4-containing receptors in multiple conformational states during the gating process. This would provide a dynamic view of how acetylcholine binding induces the "extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel" . Complementing cryo-EM with computational methods like molecular dynamics simulations would further enhance understanding of conformational dynamics and energy landscapes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.