Recombinant Rat Neuropeptide FF receptor 1 (Npffr1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Neuropeptide FF Receptor 1 (NPFFR1)

Recombinant Rat Neuropeptide FF Receptor 1 (NPFFR1), also known as GPR147 or RFamide-related peptide receptor, is a G protein-coupled receptor (GPCR) critical for modulating physiological processes such as pain perception, opioid tolerance, and neuroendocrine functions. Its recombinant form is produced in E. coli and serves as a tool for studying receptor-ligand interactions, signaling pathways, and therapeutic applications in vitro and in vivo. NPFFR1 is distinct from its paralog NPFFR2, with species-specific distribution patterns and ligand preferences.

Receptor Structure and Ligand Specificity

NPFFR1 binds preferentially to neuropeptide VF (NPVF, VPNLPQRF-NH₂) and related RFamide peptides, such as NPSF and RFRP-3, with higher affinity compared to NPFFR2 . Key structural features include:

  • Seven transmembrane domains characteristic of GPCRs.

  • Extracellular N-terminus and intracellular C-terminus for ligand binding and G protein coupling.

Signaling Pathways

NPFFR1 activation triggers downstream pathways via Gi/o proteins, including:

  1. Wnt/β-catenin signaling: Mediates osteogenic differentiation in bone mesenchymal stem cells (BMSCs) .

  2. miR-181c-3p/AGO1 pathway: Regulates angiogenesis by modulating Argonaute1 (AGO1) expression in human umbilical vein endothelial cells (HUVECs) .

In Vitro Studies

ApplicationMethodKey FindingsReference
AngiogenesisTube formation assay (HUVECs)NPVF (0.1–1 nM) increases tube formation; reversed by antagonist RF9 .
OsteogenesisWnt/β-catenin activation (BMSCs)NPVF enhances β-catenin nuclear translocation and osteogenic markers (e.g., ALP, COL1) .
MigrationWound healing/transwell assaysNPVF promotes HUVEC migration via NPFFR1; RF9 counteracts effects .

In Vivo Models

  • Bone regeneration: Hydroxyapatite scaffolds coated with NPVF-fused amyloid proteins enhance angiogenesis and osteogenesis in rat calvarial defects .

  • Pain modulation: NPFFR1 interacts with opioid receptors, influencing analgesia and opioid tolerance .

Ligand Activity Comparison

LigandSequenceReceptor AffinityPrimary Effects
NPVFVPNLPQRF-NH₂High affinity for NPFFR1 Angiogenesis, osteogenesis
NPFFFLFQPQRF-NH₂Higher affinity for NPFFR2 Nociception, opioid modulation
RF9AntagonistReverses NPVF-induced effects Inhibits NPFFR1/NPFFR2 activity

Species-Specific Distribution

  • Rat CNS: NPFFR1 is expressed in limbic regions, hypothalamus, and pituitary .

  • Human spinal cord: NPFFR1 predominates over NPFFR2, unlike rodents .

Bone Regeneration

NPVF-coated hydroxyapatite scaffolds enhance bone repair via NPFFR1-mediated angiogenesis and osteogenesis, offering potential for tissue-engineered bone substitutes .

Pain Management

NPFFR1 antagonists (e.g., RF9) may counteract opioid-induced hyperalgesia and tolerance, though mechanisms remain under investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Npffr1; Gpr147; Npff1; Neuropeptide FF receptor 1; G-protein coupled receptor 147; RFamide-related peptide receptor OT7T022
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEAEPSQPPNGSWPLGQNGSDVETSMATSLTFSSYYQHSSPVAAMFIAAYVLIFLLCMVG NTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALFTIAVIWALALLIMCPSAVTL TVTREEHHFMLDARNRSYPLYSCWEAWPEKGMRKVYTAVLFAHIYLVPLALIVVMYVRIA RKLCQAPGPARDTEEAVAEGGRTSRRRARVVHMLVMVALFFTLSWLPLWVLLLLIDYGEL SELQLHLLSVYAFPLAHWLAFFHSSANPIIYGYFNENFRRGFQAAFRAQLCWPPWAAHKQ AYSERPNRLLRRRVVVDVQPSDSGLPSESGPSSGVPGPGRLPLRNGRVAHQDGPGEGPGC NHMPLTIPAWNI
Uniprot No.

Target Background

Function
This receptor acts as a binding site for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. It can also be activated by various naturally occurring or synthetic FMRF-amide-like ligands. This receptor mediates its function by associating with G proteins, which in turn activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in the hypothalamus. Moderate levels found in the midbrain, thalamus, medulla oblongata, testis, eye, whole brain, cerebral cortex, striatum, hippocampus, cerebellum, optic nerve, placenta, spinal cord, pituitary gland and ovary.

Q&A

What is Neuropeptide FF Receptor 1 and how does it differ from NPFFR2?

Neuropeptide FF Receptor 1 (Npffr1, also known as GPR147) is one of two G protein-coupled receptors that bind Neuropeptide FF (NPFF) and related RF-amide peptides. While NPFF binds with high affinity to both receptor subtypes, NPFFR1 displays distinct binding preferences compared to NPFFR2. The human NPFFR1 binds NPFF with a Kd of 1.13 nM, whereas human NPFFR2 exhibits a slightly higher affinity with a Kd of 0.37 nM . The primary functional distinction between these receptors lies in their distribution and physiological roles. NPFFR1 is predominantly associated with neuroendocrine functions, while NPFFR2 is typically localized to pain-processing regions in most mammalian species (with humans being a notable exception where NPFFR1 is also present in spinal cord) .

What is the distribution pattern of Npffr1 in rat tissues?

Gene expression of rat Npffr1 is predominantly observed in the central nervous system, with significant expression in the brain and spinal cord, and relatively lower expression in peripheral tissues . At the cellular level, it's important to note that NPFF mRNA is expressed in cell bodies, whereas NPFF immunoreactivity is often detected in nerve terminals . The distribution pattern correlates with the proposed functions of NPFF in neuroendocrine regulation. Radioligand binding studies using [125I][Tyr1]NPFF have confirmed the presence of binding sites in rat brains, providing further validation of receptor distribution patterns .

What are the endogenous ligands for Npffr1 and their relative binding affinities?

The primary endogenous ligands for Npffr1 include members of the RF-amide peptide family, particularly RFRP peptides (NPSF/RFRP-1 and NPVF/RFRP-3). While NPFF can bind to both receptor subtypes, NPFFR1 preferentially binds RFRP peptides such as GnIH (gonadotropin-inhibitory hormone) . The table below summarizes key ligands and their properties:

LigandSequenceReceptor BindingActivity TypeBinding AffinityFunctions
NPFF (F8Fa)FLFQPQRF-NH₂NPFFR1 & NPFFR2AgonisthNPFFR1: Kd = 1.13 nM hNPFFR2: Kd = 0.21-0.37 nMPain modulation, Opioid effects, Cardiovascular activity
[Tyr¹]NPFF (Y8Fa)YLFQPQRF-NH₂NPFFR1 & NPFFR2AgonistRat spinal cord: Ki = 0.20 nMPain modulation, Anorectic effects
RFRP/GnIHVaries by speciesPreferential for NPFFR1AgonistHigher selectivity for NPFFR1Neuroendocrine regulation

What expression systems are optimal for recombinant rat Npffr1 production?

When expressing recombinant rat Npffr1, the choice of expression system significantly impacts receptor functionality and experimental outcomes. The most commonly used mammalian expression systems include COS-7 cells and HEK293 cells, which offer proper post-translational modifications essential for receptor function . For binding studies, these systems have been validated through radioligand binding assays using [125I][Tyr1]NPFF as a tracer.

For functional studies, consideration should be given to the signaling pathways being investigated. Npffr1 primarily couples to Gi proteins, inhibiting cAMP production upon activation. Therefore, experimental design should incorporate appropriate assay readouts such as inhibition of forskolin-stimulated cAMP accumulation or measurement of downstream signaling events. When designing recombinant constructs, researchers should consider including epitope tags that do not interfere with ligand binding or receptor trafficking, typically at the N-terminus or within intracellular loops.

How can I assess ligand selectivity between NPFFR1 and NPFFR2 in recombinant systems?

Determining ligand selectivity between NPFFR1 and NPFFR2 requires careful experimental design due to their cross-reactivity. A methodological approach involves:

  • Establishing stable cell lines expressing each receptor subtype individually

  • Conducting competitive binding assays using a panel of ligands against a standard radioligand (e.g., [125I][Tyr1]NPFF)

  • Determining EC50/IC50 values through dose-response curves in functional assays

  • Calculating selectivity ratios by comparing binding affinities or functional potencies between the two receptors

Recent structural studies have identified key residues that determine ligand selectivity. Specifically, mutations at positions Q37ᴺᵗ, I293⁶·⁵⁸, and T307⁷·³¹ in NPFFR1 to the corresponding NPFFR2 residues (Leu, Ser, and Asn) resulted in reversed selectivity, with a 30-fold decrease in affinity for GnIH and a 2-fold increase in affinity for NPFF . These findings provide valuable guidance for designing experiments to investigate selectivity mechanisms.

What pharmacological tools are available for studying recombinant rat Npffr1?

Several pharmacological tools have been developed for studying Npffr1, though many lack strong subtype selectivity. The most significant tools include:

  • RF9: A potent NPFF receptor antagonist that blocks effects of NPFF both in vitro and in vivo. RF9 displays similar affinity for both receptor subtypes and can effectively block the increase in blood pressure and heart rate evoked by NPFF administration .

  • 1DMe: A metabolically stable NPFF analog ([D-Tyr¹,(NMe)Phe³]YLFQPQRF-NH₂) with high affinity for Npffr1 (Ki = 2.0-7 nM) .

  • Radioligands: [125I][Tyr¹]NPFF serves as a useful tracer for binding studies in both native tissues and recombinant systems .

When designing pharmacological experiments, it's critical to include appropriate controls that account for potential off-target effects, particularly at opioid receptors, as RF9 has shown slight competition at μ and κ opioid receptors at high concentrations (10 μM) .

How can site-directed mutagenesis be used to investigate Npffr1 structural determinants of ligand binding?

Site-directed mutagenesis represents a powerful approach for investigating the structural basis of ligand binding and selectivity in Npffr1. Based on recent structural insights, strategic mutation targets should focus on:

  • Ligand-binding pocket residues: Recent cryo-EM structures have revealed that the hydrophilicity of the ligand-binding pocket, particularly residues interacting with the 5th and 6th positions from the C-terminus of peptide ligands, is critical for ligand selectivity . For Npffr1, key hydrophobic residues include I293⁶·⁵⁸, T307⁷·³¹, and F311⁷·³⁵, which form a hydrophobic environment preferring ligands with hydrophobic residues like Leu at the (-5) position .

  • N-terminal domain residues: Residues in the N-terminal domain, particularly Q37ᴺᵗ in Npffr1 (corresponding to L39ᴺᵗ in NPFFR2), play significant roles in ligand selectivity .

  • Extracellular loop residues: Residues in ECL1 and ECL2, such as T106ᴱᶜᴸ¹ and S202ᴱᶜᴸ² in Npffr1, contribute to the polar environment that interacts with specific ligand positions .

A systematic alanine scanning mutagenesis approach, followed by binding and functional assays, would help identify critical residues. Further, reciprocal mutations between Npffr1 and Npffr2 can confirm the roles of specific residues in ligand selectivity, as demonstrated by the triple mutant (Q37ᴺᵗL, I293⁶·⁵⁸S, T307⁷·³¹N) that exhibited reversed selectivity compared to wild-type Npffr1 .

What methodologies are optimal for investigating Npffr1-mediated signaling pathways?

Investigating Npffr1-mediated signaling requires multiple complementary approaches:

  • G protein coupling assays: Since Npffr1 primarily couples to Gi proteins, researchers should employ assays measuring inhibition of adenylyl cyclase, such as BRET-based sensors or cAMP accumulation assays following forskolin stimulation. The use of pertussis toxin can confirm Gi involvement.

  • Arrestin recruitment: BRET or FRET-based assays can measure β-arrestin recruitment following receptor activation, providing insights into desensitization mechanisms.

  • Downstream signaling: Measure activation of ERK1/2, Akt, or other kinases through phospho-specific antibodies in Western blotting or cell-based ELISA approaches.

  • Receptor internalization: Fluorescently tagged receptors can be monitored using confocal microscopy or flow cytometry to assess internalization kinetics following ligand stimulation.

  • Electrophysiological recordings: For neuronal preparations, whole-cell patch-clamp recordings can assess effects on ion channels modulated by Gi-coupled receptor activation, such as GIRK channels.

When investigating potential bias signaling (preferential activation of specific pathways), it's essential to generate full dose-response curves for multiple pathways and calculate bias factors through operational models.

How can I develop strategies to improve subtype selectivity between NPFFR1 and NPFFR2?

Developing subtype-selective ligands requires understanding the structural basis for selectivity. Based on recent structural insights , several approaches can be employed:

  • Structure-guided design: Utilizing the cryo-EM structure of NPFFR2 and homology models of NPFFR1, design peptides that exploit differences in the binding pockets. Specifically, focus on positions (-5) and (-6) from the C-terminus, as NPFFR1 prefers hydrophobic residues like Leu at position (-5) and polar residues at position (-6), whereas NPFFR2 has opposite preferences .

  • Peptidomimetic approach: Develop non-peptide or peptidomimetic compounds that maintain essential pharmacophore features while enhancing selectivity. The development of RF9 demonstrated that small dipeptide derivatives can maintain high receptor affinity .

  • Allosteric modulators: Explore potential allosteric binding sites that may differ between receptor subtypes, offering greater selectivity than orthosteric ligands.

  • Biased ligands: Design ligands that preferentially activate specific signaling pathways downstream of each receptor subtype, potentially offering functional selectivity even without binding selectivity.

A combination of computational approaches (molecular docking, molecular dynamics simulations) with empirical testing through binding and functional assays would optimize this development process.

How does Npffr1 activation modulate opioid receptor signaling and tolerance?

Npffr1 activation plays a significant role in modulating opioid receptor signaling through what has been described as an "antiopioid system" . The methodological approach to investigating this interaction involves:

  • Co-expression studies: Examining signaling crosstalk in cells co-expressing Npffr1 and various opioid receptor subtypes (μ, δ, κ).

  • Behavioral pharmacology: Utilizing selective agonists and antagonists (such as RF9) to study the impact on opioid-induced analgesia, tolerance, and dependence in rodent models.

  • Electrophysiology: Measuring cellular responses in neurons expressing both receptor systems to determine how Npffr1 activation modifies opioid receptor-mediated effects on neuronal excitability.

Research has demonstrated that NPFF receptor antagonist RF9, when chronically co-injected with heroin, completely blocks the delayed and long-lasting paradoxical opioid-induced hyperalgesia and prevents the development of associated tolerance . This finding provides strong evidence that NPFF receptors, including Npffr1, constitute a bona fide antiopioid system that can modulate opioid effects. The mechanism likely involves both direct receptor interactions and overlapping second messenger systems.

What are the methodological considerations for studying Npffr1 in pain modulation?

Studying Npffr1 in pain modulation requires multiple complementary approaches:

  • Animal models of pain: Utilize various pain models including acute (thermal, mechanical), inflammatory (carrageenan, CFA), and neuropathic (nerve injury, chemotherapy-induced) pain models to comprehensively assess Npffr1 involvement in different pain states.

  • Pharmacological interventions: Administer Npffr1 agonists or antagonists through different routes (intrathecal, intracerebroventricular, systemic) to determine site-specific effects.

  • Genetic approaches: Employ Npffr1 knockout models or siRNA-mediated knockdown to assess receptor contributions to pain processing.

  • Electrophysiological recordings: Record from dorsal horn neurons in spinal cord slices to determine how Npffr1 modulates synaptic transmission in pain circuits.

  • Cellular assays: Examine calcium influx, cAMP levels, and other signaling events in dorsal root ganglia neurons expressing Npffr1.

A critical methodological consideration is the species-specific distribution of NPFF receptors. While NPFFR2 is localized to pain-processing regions in rodents, NPFFR1 appears to fulfill this role in humans . Therefore, translational aspects must be carefully considered when interpreting results from rat models for potential human applications.

How can recombinant Npffr1 be used to screen for novel therapeutic compounds?

Recombinant Npffr1 provides an excellent platform for high-throughput screening of novel therapeutic compounds. A comprehensive screening strategy should include:

  • Primary binding screens: Competitive binding assays using radiolabeled ligands (e.g., [125I][Tyr¹]NPFF) to identify compounds that interact with the receptor.

  • Functional assays: Measure Gi-mediated inhibition of cAMP production following forskolin stimulation to identify functional agonists and antagonists.

  • Selectivity profiling: Test active compounds against NPFFR2 and related receptors (opioid receptors, other RFamide receptors) to determine selectivity profiles.

  • Structure-activity relationship (SAR) studies: Systematically modify lead compounds to optimize affinity, selectivity, and physicochemical properties.

  • In silico screening: Utilize the crystal structure information and homology models for virtual screening of compound libraries before experimental testing.

When developing antagonists like RF9, it's essential to verify their ability to block endogenous ligand effects both in vitro and in vivo. RF9 has demonstrated the capacity to block the increase in blood pressure and heart rate evoked by NPFF administration , providing a valuable proof-of-concept for therapeutic antagonist development. For potential clinical applications in pain management, compounds that can block NPFF-induced anti-opioid effects could be valuable adjuncts to opioid analgesics, potentially allowing lower doses and reducing tolerance development.

What are the common pitfalls in recombinant Npffr1 expression and how can they be overcome?

Recombinant expression of GPCRs like Npffr1 presents several technical challenges:

  • Low expression levels: Optimize codon usage for the expression system, use strong promoters, and consider adding signal sequences to enhance membrane targeting. The inclusion of BRIL fusion proteins has proven successful for structural studies of NPFFRs .

  • Receptor misfolding: Include chaperone proteins in expression systems, optimize growth temperatures (often lower temperatures improve folding), and consider adding stabilizing mutations identified through alanine scanning.

  • Poor membrane trafficking: Verify proper glycosylation by Western blotting with and without glycosidase treatment. N-terminal epitope tags can be used to monitor surface expression through ELISA or flow cytometry.

  • Constitutive activity: Include negative control cells (non-transfected or expressing an unrelated receptor) to establish baselines for signaling assays. Inverse agonists may be useful for controlling constitutive activity.

  • Heterogeneous glycosylation: Use expression systems with more homogeneous glycosylation patterns or enzymatically remove glycans before certain applications.

For structural studies, the recent cryo-EM structure of NPFFR2 employed the use of BRIL fusion proteins and antibody fragments (Fab) to stabilize the receptor conformation, which could be adapted for Npffr1 studies .

How can I troubleshoot inconsistent results in Npffr1 functional assays?

Inconsistent results in functional assays often stem from several factors:

  • Receptor expression variability: Establish stable cell lines rather than relying on transient transfection. Quantify receptor expression levels across experiments using radioligand binding or flow cytometry.

  • Peptide degradation: Include protease inhibitors in assay buffers. For peptide ligands, consider using metabolically stable analogs like 1DMe ([D-Tyr¹,(NMe)Phe³]YLFQPQRF-NH₂) .

  • Cell passage effects: Maintain consistent cell passage numbers for experiments, typically using cells between passages 5-25 after stable transfection.

  • Signaling pathway cross-talk: Be aware of endogenous receptor expression in host cells that might interfere with signaling readouts. Use selective inhibitors to isolate specific pathways.

  • Assay conditions: Standardize assay conditions including buffer composition, pH, temperature, and incubation times. For cAMP assays, the timing of forskolin addition and sample collection is critical.

Implementing positive controls (known Npffr1 agonists like RFRP peptides) and negative controls (buffer only, non-transfected cells) in each experiment helps normalize results and identify potential issues.

What are the current limitations in studying Npffr1 and potential future directions?

Current limitations in Npffr1 research include:

  • Limited structural information: While the cryo-EM structure of NPFFR2 has been determined , no direct structural data exists for Npffr1. Future directions should include structural determination of Npffr1 in both inactive and active states.

  • Poor subtype selectivity of available tools: Most available ligands lack strong selectivity between NPFFR1 and NPFFR2. Development of highly selective agonists and antagonists remains a priority.

  • Incomplete understanding of signaling bias: Further investigation into potential biased signaling properties of different ligands could reveal important functional distinctions.

  • Limited knowledge of receptor regulation: More research is needed on receptor phosphorylation sites, internalization mechanisms, and recycling pathways.

  • Translational challenges: Species differences in receptor distribution (particularly human vs. rodent) complicate translation of findings from animal models to humans .

Future directions should include:

  • Development of subtype-selective ligands based on structural insights

  • More detailed mapping of receptor-ligand interactions through hydrogen-deuterium exchange mass spectrometry or other biophysical techniques

  • Investigation of heterodimer formation between Npffr1 and other GPCRs, particularly opioid receptors

  • Exploration of tissue-specific signaling differences using primary cell cultures

  • Development of in vivo imaging tools for studying receptor occupancy and function

The recent structural insights into NPFFR2 provide a valuable template for understanding Npffr1 function, but direct structural studies of Npffr1 would significantly advance the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.