Recombinant Rat Neuropeptide Y receptor type 5 (Npy5r)

Shipped with Ice Packs
In Stock

Description

Introduction to Neuropeptide Y Receptor Type 5

Neuropeptide Y receptor type 5 (Npy5r) belongs to the neuropeptide Y receptor family of G-protein coupled receptors that mediate the biological actions of neuropeptide Y (NPY) and peptide YY . The NPY system represents a highly conserved, stress-activated signaling network involved in diverse biological functions and pathological processes including metabolic regulation and cancer development . Npy5r specifically functions as a receptor for both neuropeptide Y and peptide YY, mediating their effects through inhibition of adenylate cyclase activity .

The NPY receptor system has gained significant research attention due to its involvement in multiple physiological processes. Particularly, Npy5r has been implicated in the regulation of feeding behavior, potentially playing a role in feeding disorders . This connection to appetite regulation makes the receptor a subject of interest in metabolic research, especially concerning obesity and related conditions.

In rat models, Npy5r demonstrates interesting expression patterns that vary with age and physiological conditions. Research using gene expression analysis has revealed age-dependent upregulation of this receptor in rat liver tissues, suggesting its potential involvement in age-related physiological changes . The conservation of this receptor across mammalian species highlights its fundamental biological importance and makes the rat model particularly valuable for translational research.

Recombinant Production of Rat Npy5r

The production of recombinant rat Npy5r has revolutionized research into this important receptor by providing purified protein for structural studies, antibody development, and functional characterization. Multiple expression systems have been developed for the production of recombinant rat Npy5r, each offering distinct advantages for specific research applications.

Expression Systems for Recombinant Rat Npy5r

Several expression platforms are currently utilized for the production of recombinant rat Npy5r, including:

  1. E. coli Expression System: This bacterial system offers high protein yields and cost-effectiveness for producing recombinant rat Npy5r. The in vitro E. coli expression system represents a standard approach for generating substantial quantities of the receptor protein for various applications .

  2. Yeast-Based Production: Yeast expression systems provide eukaryotic post-translational modifications that may enhance the functionality of recombinant rat Npy5r compared to bacterial systems .

  3. Baculovirus Expression: This insect cell-based system offers improved protein folding and post-translational modifications compared to prokaryotic systems, potentially yielding recombinant rat Npy5r with greater structural fidelity to the native protein .

  4. Mammalian Cell Expression: Mammalian expression systems provide the most physiologically relevant cellular environment for producing recombinant rat Npy5r, particularly when studying receptor function in contexts requiring mammalian-specific modifications and processing .

  5. In Vivo Biotinylation in E. coli: This specialized approach incorporates biotin tags into the recombinant rat Npy5r structure, facilitating downstream applications such as purification and detection .

These diverse expression platforms enable researchers to select the most appropriate system based on their specific experimental requirements, whether focusing on protein quantity, structural integrity, or functional properties.

Rat Npy5r mediates diverse physiological functions through its interaction with neuropeptide Y and related peptides. Understanding these functional properties provides insights into the receptor's role in normal physiology and potential involvement in pathological conditions.

Signaling Mechanisms

The primary signaling mechanism of rat Npy5r involves inhibition of adenylate cyclase activity through coupling with inhibitory G proteins . This mechanism leads to decreased intracellular cAMP levels, modulating numerous downstream cellular processes. Additionally, research has shown that Npy5r activation can trigger other signaling pathways, particularly the MAPK/ERK pathway which is involved in cell proliferation and survival .

Interestingly, studies in HCC models have demonstrated that activation of Y5R by NPY induces ERK activation at even low nanomolar concentrations, while appearing not to affect AKT activation . This selective pathway activation highlights the specificity of Npy5r signaling and its potential importance in cellular regulation.

Physiological Functions

Rat Npy5r appears to be involved in several important physiological functions:

  1. Feeding Regulation: Evidence suggests that Npy5r is associated with food intake regulation and may be involved in feeding disorders . The NPY system broadly functions as a key regulator of feeding behavior, with Npy5r potentially mediating specific aspects of appetite control.

  2. Age-Related Processes: Research has demonstrated age-dependent upregulation of Npy5r in rat liver tissues, suggesting involvement in age-associated physiological changes . This age-dependent expression pattern indicates potential roles in tissue aging and related processes.

  3. Cell Proliferation and Survival: Functional studies have shown that Y5R signaling can promote cell proliferation and survival in certain contexts, as demonstrated by the effects of Y5R inhibition on reducing proliferation markers like Ki-67 .

The diverse functional properties of rat Npy5r underscore its biological significance and potential as a therapeutic target for various conditions, particularly those related to metabolic regulation and cellular proliferation.

Role of Rat Npy5r in Disease Models

Research utilizing rat models has provided valuable insights into the potential involvement of Npy5r in various pathological conditions, particularly in cancer development and progression.

Cancer-Related Functions

Studies in hepatocellular carcinoma (HCC) models have revealed significant upregulation of Y5R expression in tumor tissues compared to corresponding non-tumorous tissues . This upregulation appears to be functionally important, as Y5R has been shown to promote tumor progression through several mechanisms:

  1. Proliferation Enhancement: Y5R activation promotes cell proliferation in HCC, as evidenced by correlation between Y5R expression and proliferation markers like cyclin D1 and Ki-67 .

  2. Clonogenicity Promotion: Research demonstrates that Y5R signaling enhances both number and size of colonies formed by cancer cells, suggesting a role in promoting cancer stem cell-like properties .

  3. ERK Pathway Activation: Y5R activation by NPY triggers ERK signaling, a pathway known to regulate cell proliferation and survival .

The cancer-promoting effects of Y5R highlight its potential as a therapeutic target in certain malignancies. Importantly, pharmacological inhibition or RNAi-mediated knockdown of Y5R in experimental models has been shown to significantly reduce tumor formation and growth, supporting the therapeutic potential of targeting this receptor .

Intercellular Signaling in Disease Contexts

A particularly interesting aspect of Y5R function revealed through rat models is its involvement in intercellular communication within the tumor microenvironment. Research has demonstrated that hepatocytes surrounding tumor tissue produce NPY, which then activates Y5R on cancer cells to promote tumor progression . This cross-talk between normal hepatocytes and cancer cells represents an important mechanism of tumor promotion and highlights the complexity of Y5R signaling in pathological contexts.

The identification of this paracrine signaling mechanism, where NPY produced by peritumorous hepatocytes drives cancer progression through Y5R activation on tumor cells, opens new avenues for therapeutic intervention targeting the tumor microenvironment .

Applications of Recombinant Rat Npy5r in Research

Recombinant rat Npy5r serves as a valuable research tool for investigating receptor structure, function, and potential therapeutic applications. The availability of purified recombinant protein has facilitated numerous experimental approaches that continue to advance our understanding of this important receptor.

Development of Therapeutic Approaches

Research utilizing recombinant rat Npy5r has contributed to the development of therapeutic strategies targeting this receptor. These approaches include:

  1. Small-Molecule Inhibitors: Development and testing of Y5R-specific inhibitors that have shown promise in reducing tumor formation and growth in experimental models .

  2. Antagonist Screening: High-throughput screening for novel Y5R antagonists using recombinant protein as a target.

  3. Targeting Receptor-Ligand Interactions: Development of strategies to disrupt the interaction between NPY and Y5R, such as NPY-neutralizing antibodies that have been shown to significantly reduce the proliferation of cancer cells .

The availability of well-characterized recombinant rat Npy5r from various expression systems continues to accelerate research in these areas, potentially leading to new therapeutic approaches for conditions involving dysregulated NPY signaling.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time estimates, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Npy5r; Npyr5; Neuropeptide Y receptor type 5; NPY5-R; NPY-Y5 receptor; NPYY5-R; Y5 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEFKLEEHFNKTFVTENNTAAARNAAFPAWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNL LILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFL QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL VELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC GLSHKENRLEENEMINLTLQPSKKSRNQAKTPSTQKWSYSFIRKHRRRYSKKTACVLPAP AGPSQGKHLAVPENPASVRSQLSPSSKVIPGVPICFEVKPEESSDAHEMRVKRSITRIKK RSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLN PILYGFLNNGIKADLRALIHCLHMS
Uniprot No.

Target Background

Function
This receptor functions as a receptor for neuropeptide Y and peptide YY. Its activity is mediated by G proteins, which inhibit adenylate cyclase activity. It is believed to be associated with food intake and may play a role in feeding disorders.
Gene References Into Functions
  1. NPY and agonists of Y2R and Y5R have neuroprotective effects against oxygen-glucose deprivation-induced neuronal cell death in primary cortical cell cultures following delayed treatment. A Y2R agonist not only alleviates transient cerebral ischemia-induced neuronal damage but also improves functional outcomes after delayed administration. Y5 and particularly Y2 receptors hold promise as targets for neuroprotection against ischemic damage. PMID: 28057538
  2. Long-term overexpression of NPY in the paraventricular nucleus contributes to the development of adipose tissue insulin resistance, at least partially through the Y5 receptor. PMID: 25993471
  3. Our research demonstrated altered expression of NPY, Y1R, and Y2R, but not Y5R, in the hippocampus and temporal lobe cortex of tremor rat brains. PMID: 24444822
  4. Y5R does not participate in the anorectic response to phenylpropanolamine. PMID: 23179670
  5. Our findings indicate that while signals mediated through NPY Y1 receptors play a modest role in reinstatement, activation of Y5 receptors plays a crucial function in food deprivation-induced reinstatement of heroin-seeking behavior. PMID: 21629996
  6. Inhibition of central Y5 neurotransmission resulted in activation of the thyroid axis during fasting, suggesting that NPY-Y5 receptors contribute to fasting-induced TSH and TH suppression. PMID: 21771616
  7. NPY and Y5R expression increased by over 130-fold and decreased by 28-fold, respectively, in old bone marrow cells compared to young bone marrow cells. PMID: 21595512
  8. Through a specific Y-1R/Y-5R interplay, NPY acts as a neuroimmune co-transmitter in vivo. PMID: 12417430
  9. Data suggest that overactivity of the neuropeptide Y, neuropeptide Y-1 receptor, and neuropeptide Y-5 receptor gene expression may contribute to the development of obesity in OM rats. PMID: 12429884
  10. Data confirm the importance of both neuropeptide Y1 and Y5 receptors in the neuropeptide Y-mediated increase in food consumption and demonstrate that both receptors can mediate inhibitory effects of neuropeptide Y on the hypothalamo-pituitary-thyroid axis. PMID: 12446577
  11. Comparative mapping of Y1 and Y5 receptor subtypes within cell bodies and nerve fibers in the brain, together with physiological and electrophysiological studies, provide a better understanding of NPY neural circuitries. PMID: 12900925
  12. Decreased expression and number of Y(5) receptors in the hypothalamic paraventricular nucleus cannot explain the attenuated responsiveness of the senescent rats to exogenous neuropeptide Y. PMID: 15044185
  13. We investigated the regulation of BDNF and NPY mRNA and Y1-, Y2-, and Y5-like receptor binding in the hippocampus of vehicle-pretreated, partially and fully amygdala-kindled rats and corresponding levetiracetam-pretreated rats (40 mg/kg i.p.). PMID: 15123022
  14. Data reveal an NPY Y1 and Y2/Y5 receptor interaction in NPY-induced modulation of macrophage functions related to inflammation. PMID: 15544855
  15. Y5 receptors mediate inhibitory effects of NPY in kindling and display anticonvulsant rather than antiepileptogenic effects upon agonist stimulation. PMID: 15582717
  16. Results describe the distribution of neuropeptide Y Y5 receptor-like immunoreactivity in the rat brain. PMID: 16954600
  17. Selective stimulation of the Y(5) receptor provokes activation of the HPA axis, and its downstream pathway is primarily composed of both CRF (primary regulator) and AVP (subordinate to the former) with distinct relative contributions. PMID: 17363455
  18. These results suggest that, in addition to regulating feeding behavior, the Y5 receptor subtype may have previously unrecognized roles in controlling nesting behavior during lactation, with subsequent effects on litter growth rates. PMID: 19419662

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain; hypothalamus.

Q&A

What is Neuropeptide Y receptor type 5 (NPY5R) and what are its main functions in rat models?

Neuropeptide Y receptor type 5 (NPY5R) is a G-protein coupled receptor belonging to the subfamily of neuropeptide Y receptors that mediates the action of endogenous neuropeptide Y (NPY). It contains 456 amino acids and is widely distributed in the mammalian brain, with particularly high expression in the cortex, putamen, and caudate nucleus. NPY5R primarily functions by inhibiting adenylate cyclase activity in response to ligand binding .

In rat models, NPY5R plays a critical role in appetite regulation, as evidenced by food intake studies showing significant stimulation of feeding behavior following administration of Y5 receptor-selective agonists . This confirms the receptor's importance in energy homeostasis and feeding regulation pathways. Studies in knockout mice have demonstrated that animals lacking the NPY5R gene show altered food preferences, specifically failing to prefer food odors over pheromones after fasting periods .

Beyond feeding behavior, NPY5R is also involved in cell growth regulation and has been implicated in apoptotic pathways, suggesting multifaceted biological functions beyond its classical role in appetite control. These diverse functions make it an important target for research across various physiological systems.

How does rat NPY5R differ structurally and functionally from human NPY5R?

Rat and human NPY5R share considerable homology but exhibit species-specific differences that can impact experimental design and data interpretation. While both receptor variants maintain the core structure of a G-protein coupled receptor with seven transmembrane domains, they differ in key amino acid sequences that can affect ligand binding profiles and downstream signaling efficiency.

The human NPY5R is located on chromosome 4q31-q32, encoding a 456-amino acid protein that functions primarily through inhibitory G-proteins to reduce adenylate cyclase activity . In contrast, the rat variant may exhibit subtle differences in binding pocket architecture that influence the affinity and selectivity of various ligands. These differences become particularly important when developing receptor-specific agonists or antagonists.

Functionally, both receptors respond to the same endogenous ligands (NPY and PYY), but with potentially different binding affinities and activation thresholds. This becomes critically important when translating findings from rat models to human applications. For example, the Y5 receptor-selective analog [Ala(31),Aib(32)]NPY shows an affinity of 6 nM at the human Y5 receptor , but researchers should not assume identical binding kinetics in rat models without species-specific validation.

What are the key ligands for NPY5R and their relative binding affinities?

NPY5R interacts with several endogenous and synthetic ligands with varying degrees of affinity and selectivity. The primary endogenous ligands for NPY5R are neuropeptide Y (NPY) and peptide YY (PYY), which bind with high affinity in the nanomolar range. Unlike other NPY receptor subtypes, NPY5R can accept peptides with deletion of the first residue while maintaining functional activity .

The first selective agonist developed specifically for NPY5R was [Ala(31),Aib(32)]NPY, which demonstrates remarkable selectivity across the NPY receptor family. This analog shows an affinity of 6 nM at the human Y5 receptor, while exhibiting >500 nM affinity at Y1 and Y2 receptors, and >1000 nM at the Y4 receptor . This selective binding profile makes it an invaluable tool for isolating Y5R-specific responses in experimental systems.

Further refinements combining the Ala(31)-Aib(32) motif with chimeric peptides containing segments of NPY and pancreatic polypeptide (PP) have yielded even more potent ligands, with affinities reaching as high as 0.2 nM for the Y5 receptor . These high-affinity selective ligands provide powerful tools for investigating NPY5R function in complex physiological systems where multiple NPY receptor subtypes may be present.

What are the recommended methods for expressing recombinant rat NPY5R in different cell systems?

Successful expression of recombinant rat NPY5R requires careful consideration of the expression system and optimization of protocols to ensure proper protein folding and membrane integration. Several cell systems have been effectively utilized for NPY5R expression, each with distinct advantages depending on the research objectives.

For mammalian expression systems, human embryonic kidney (HEK293) cells and Chinese hamster ovary (CHO) cells have proven particularly effective for NPY5R expression. These systems provide the appropriate post-translational modifications and cellular machinery for proper receptor folding and trafficking. A recommended approach involves:

  • Cloning the rat NPY5R coding sequence into a mammalian expression vector (such as pcDNA3.1+) containing a strong promoter (CMV) and appropriate selection marker

  • Transfecting the expression construct into the chosen cell line using lipid-based transfection reagents

  • Selecting stable transfectants using appropriate antibiotics

  • Validating expression through RT-PCR, western blot analysis, and functional assays

For example, in breast cancer cell lines such as MDA-MB-231 and SK-BR-3 that lack endogenous NPY5R expression, transfection with pcDNA-NPY5R plasmid successfully established NPY5R expression as confirmed by both RT-PCR and western blot analysis . This approach allows for gain-of-function studies to investigate NPY5R-mediated effects in cellular models.

How can researchers validate the functional activity of recombinant rat NPY5R?

Validating the functional activity of recombinant rat NPY5R is essential to ensure that the expressed receptor maintains physiologically relevant signaling capabilities. Multiple complementary approaches should be employed to comprehensively assess receptor functionality.

A primary validation method involves measuring inhibition of adenylate cyclase activity, as NPY5R couples primarily to inhibitory G-proteins. This can be accomplished using cAMP enzyme immunoassays following stimulation with receptor-specific agonists such as [Ala(31),Aib(32)]NPY . Functional NPY5R will demonstrate dose-dependent reductions in cAMP levels in response to agonist binding.

Additional functional validation approaches include:

  • Ligand binding assays: Competition binding assays using radiolabeled ligands can confirm the receptor's ability to bind NPY and NPY5R-selective agonists with appropriate affinity

  • G-protein coupling assays: GTPγS binding assays can measure the receptor's ability to activate G-proteins in response to agonist stimulation

  • Downstream signaling activation: Western blot analysis of phosphorylation events in relevant pathways

  • Functional cellular responses: For NPY5R, this may include assessing effects on cell proliferation, apoptosis, and cell cycle distribution by flow cytometry

For example, functional validation of NPY5R in breast cancer cell lines demonstrated that overexpression significantly suppressed cell proliferation, increased apoptosis (both early and late apoptotic cells), and induced G2/M phase cell cycle arrest, which was biochemically confirmed by decreased levels of key G2/M cell cycle regulators cyclin B1 and cdc25c .

What are the optimal conditions for maintaining stability of recombinant rat NPY5R preparations?

Maintaining the stability of recombinant rat NPY5R preparations is crucial for obtaining reliable and reproducible experimental results. As a seven-transmembrane G-protein coupled receptor, NPY5R requires specific conditions to preserve its native conformation and functional integrity.

For cell-based assays involving intact cells expressing NPY5R, the following conditions are recommended:

  • Culture medium: Complete medium appropriate for the expression system (e.g., DMEM with 10% FBS for mammalian cells) supplemented with selection antibiotics if using stable transfectants

  • Temperature: Maintain cells at 37°C in a humidified atmosphere with 5% CO2

  • Passage number: Limit the passage number of stable cell lines to prevent genetic drift and loss of expression

  • Storage: Cryopreserve multiple aliquots of early-passage stable cell lines in liquid nitrogen using 10% DMSO as a cryoprotectant

For membrane preparations containing recombinant NPY5R:

  • Buffer composition: Use physiological buffers (e.g., 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2) supplemented with protease inhibitors

  • Temperature: Store membrane preparations at -80°C and avoid repeated freeze-thaw cycles

  • Glycerol addition: Include 10-20% glycerol in storage buffers to prevent protein denaturation during freezing

  • Aliquoting: Prepare single-use aliquots to avoid repeated freezing and thawing

These careful storage and handling practices help ensure that the recombinant NPY5R maintains its structural integrity and functional properties for reliable experimental results across multiple studies.

How does NPY5R signaling interact with other receptor pathways in regulatory networks?

NPY5R signaling does not function in isolation but participates in complex cross-talk with multiple signaling pathways, forming integrated regulatory networks that coordinate cellular responses. Understanding these interactions is essential for interpreting experimental results and developing targeted interventions.

Gene co-expression network analysis of NPY5R in breast cancer revealed significant correlations with several important signaling molecules. NPY5R showed strong positive correlations with NPY1R (positive rank #2, p = 1.94e-166) and RBP7 (positive rank #3, p = 1.42e-42), suggesting coordinated regulation or functional cooperation . Conversely, NPY5R exhibited strong negative correlation with HM13 gene expression (negative rank #1, p = 2.05e-23), indicating potential antagonistic regulatory relationships .

Pathway analysis through Gene Set Enrichment Analysis (GSEA) and Kyoto Encyclopedia of Genes and Genomes (KEGG) revealed that NPY5R-coexpressed genes were significantly enriched in several key signaling pathways:

  • JAK-STAT signaling pathway: Critical for cytokine signaling and immune regulation

  • Wnt signaling pathway: Essential for development and cell fate determination

  • MAPK signaling pathway: Central to cellular responses to environmental stimuli

Functional studies in breast cancer cells demonstrated that NPY5R overexpression specifically inhibited IL6-STAT3 pathway activation, suggesting a mechanistic link between NPY5R and inflammatory signaling networks that contribute to its tumor-suppressive effects . This intersection with the IL6-STAT3 axis provides a potential molecular mechanism for NPY5R's role in regulating cell growth and survival.

What are the current approaches for studying NPY5R in cancer models, particularly breast cancer?

Research into NPY5R's role in cancer, particularly breast cancer, employs multiple complementary approaches to establish its functional significance and potential as a biomarker or therapeutic target. Current methodologies span from bioinformatic analyses to experimental manipulation in cell and animal models.

Bioinformatic analyses of public databases represent a powerful starting point. Researchers have utilized Gene Expression Profiling Interactive Analysis (GEPIA), Gene Expression Omnibus (GEO), and The Cancer Genome Atlas (TCGA) to analyze NPY5R expression patterns in breast cancer versus normal tissues . These analyses revealed significantly decreased NPY5R expression in breast tumor tissues compared to adjacent normal tissues, providing initial evidence for its potential tumor-suppressive role .

Experimental validation approaches include:

  • Expression analysis: Quantifying NPY5R levels using qPCR, western blot, and immunohistochemistry in clinical samples and cell lines

  • Genetic manipulation: Overexpressing NPY5R in cancer cell lines that lack endogenous expression (e.g., MDA-MB-231 and SK-BR-3) using plasmid transfection

  • Functional assays: Assessing effects on cellular proliferation (CCK8 assay), colony formation, apoptosis (flow cytometry), and cell cycle distribution

  • Chemosensitivity testing: Evaluating how NPY5R expression affects response to chemotherapeutic agents such as doxorubicin

  • Mechanistic studies: Investigating molecular pathways affected by NPY5R using western blot analysis of key signaling molecules (e.g., cleaved caspase-9, PARP, cyclin B1, cdc25c)

These approaches have revealed that NPY5R overexpression significantly suppresses breast cancer cell proliferation, induces apoptosis, arrests cell cycle at G2/M phase, and enhances sensitivity to doxorubicin, supporting its tumor-suppressive function .

How does receptor-specific ligand recognition occur in the NPY receptor family?

Receptor-specific ligand recognition within the NPY receptor family represents a fascinating example of how structurally divergent receptors can discriminate between highly similar peptide ligands. Despite sharing only 27-32% sequence identity, Y1R, Y2R, and Y5R all bind NPY and PYY with nanomolar affinities, suggesting sophisticated mechanisms of ligand recognition .

The NPY receptors exhibit distinct ligand binding preferences that provide insights into their recognition mechanisms:

  • N-terminal requirements: Y1R and Y4R require the full-length N-terminus of NPY for full agonist activity, while Y2R can bind N-terminally truncated NPY and PYY with high affinity. Y5R demonstrates intermediate flexibility, accepting peptides with deletion of just the first residue

  • C-terminal interactions: Y1R appears to form interactions with more residues at the peptide C-terminus than Y2R, suggesting differential engagement with this region of the peptide

  • Selective agonist development: The development of [Ala(31),Aib(32)]NPY as the first Y5R-selective agonist demonstrates how specific modifications at positions 31 and 32 can dramatically enhance selectivity for Y5R while reducing affinity for other NPY receptors

  • Conformational adaptability: Given the diversity of receptor structures coupled with similar ligand binding capabilities, the NPY peptides likely adopt distinct conformations when binding to different receptor subtypes

This structural and functional diversity within the NPY receptor family provides unique opportunities for developing subtype-selective ligands for experimental and potentially therapeutic applications.

What are common challenges in achieving proper folding and function of recombinant rat NPY5R?

Researchers working with recombinant rat NPY5R frequently encounter challenges related to proper protein folding, membrane integration, and functional expression. As a complex seven-transmembrane G-protein coupled receptor, NPY5R requires specific cellular machinery and environmental conditions to achieve its native conformation.

Common challenges and their potential solutions include:

  • Low expression levels: This may result from inefficient transcription, translation, or protein degradation. Solutions include:

    • Optimizing codon usage for the expression system

    • Using stronger promoters or enhancers

    • Adding proteasome inhibitors to prevent degradation

    • Screening multiple clones to identify high expressors

  • Improper membrane trafficking: GPCRs must be correctly inserted into the plasma membrane to function. Issues may be addressed by:

    • Adding trafficking signal sequences to the construct

    • Co-expressing chaperone proteins that facilitate folding

    • Using cell lines with demonstrated success in GPCR expression

    • Performing immunofluorescence to verify membrane localization

  • Loss of functional activity: Even when expressed, the receptor may not maintain proper conformation for ligand binding and signaling. Approaches include:

    • Careful selection of detergents if membrane preparation is required

    • Inclusion of stabilizing agents during purification

    • Maintaining physiological pH and ionic strength in buffers

    • Adding cholesterol or specific lipids to stabilize the receptor

  • Aggregation during preparation: Membrane proteins are prone to aggregation when removed from their native lipid environment. This can be mitigated by:

    • Using mild solubilization conditions

    • Adding glycerol to stabilize the protein

    • Working at reduced temperatures

    • Employing nano-disc or liposome reconstitution technologies

Establishing appropriate positive controls at each step of the expression and characterization process is essential for troubleshooting these common challenges.

How can researchers address inconsistencies in NPY5R binding assay results?

Inconsistencies in NPY5R binding assay results can arise from multiple sources, including technical variables, reagent quality, and biological factors. Systematic troubleshooting approaches can help identify and address these inconsistencies to yield reliable and reproducible data.

Key factors that may contribute to variability in binding assays include:

  • Ligand quality and stability: NPY peptides may undergo degradation or aggregation during storage. Researchers should:

    • Use freshly prepared ligand solutions when possible

    • Store peptides according to manufacturer recommendations

    • Verify ligand integrity by HPLC or mass spectrometry

    • Include positive control ligands with established binding profiles

  • Receptor expression levels: Variations in receptor density can dramatically affect binding parameters. Solutions include:

    • Quantifying receptor expression before each experiment

    • Normalizing binding data to receptor expression levels

    • Using consistent passage numbers for stable cell lines

    • Establishing standard curves with reference cell lines

  • Assay conditions: Buffer composition, pH, temperature, and incubation times can all influence binding kinetics. Researchers should:

    • Standardize and document all assay conditions

    • Include temperature and pH controls

    • Optimize incubation times for equilibrium binding

    • Determine the effect of divalent cations on binding

  • Non-specific binding: High background from non-specific interactions can mask specific binding signals. Approaches include:

    • Optimizing washing steps

    • Including appropriate blocking agents

    • Using proper controls for non-specific binding

    • Employing competitive binding approaches with selective ligands

For example, when characterizing the selective Y5R agonist [Ala(31),Aib(32)]NPY, researchers used competition binding assays on cell lines expressing different Y receptors to determine the specific affinity profile (6 nM at Y5R, >500 nM at Y1R and Y2R, and >1000 nM at Y4R) . This systematic approach across multiple receptor subtypes provided internal validation and consistency checks.

What controls are essential when evaluating NPY5R-mediated effects in cellular models?

Rigorous experimental controls are critical for establishing the specificity and validity of observed NPY5R-mediated effects in cellular models. These controls address potential confounding factors and alternative explanations for experimental outcomes.

Essential controls for NPY5R research include:

  • Expression controls:

    • Vector-only controls: Cells transfected with empty vector (e.g., pcDNA3.1+ without NPY5R) to control for effects of the transfection process

    • Quantification of NPY5R expression: RT-PCR and western blot analysis to confirm successful expression in experimental groups and absence in control groups

    • Receptor activity validation: Functional assays to confirm that expressed NPY5R maintains signaling capabilities

  • Pharmacological controls:

    • Selective agonists: Using Y5R-selective agonists like [Ala(31),Aib(32)]NPY to confirm receptor-specific effects

    • Competitive antagonists: Blocking observed effects with selective antagonists

    • Dose-response relationships: Demonstrating concentration-dependent effects consistent with receptor pharmacology

  • Signaling pathway controls:

    • Pathway inhibitors: Using specific inhibitors of downstream pathways to confirm mechanism

    • Readout specificity: Ensuring that observed effects (e.g., changes in cell cycle distribution) are specific to NPY5R activation rather than non-specific cellular stress

    • Temporal controls: Establishing appropriate time points for measuring acute versus chronic effects

  • Genetic controls:

    • siRNA knockdown: Reducing NPY5R expression in cells with endogenous expression

    • Rescue experiments: Restoring function by reintroducing NPY5R in knockout models

    • Multiple cell lines: Confirming effects across different cellular backgrounds

For example, research demonstrating NPY5R's tumor-suppressive effects in breast cancer employed vector-only controls, confirmed NPY5R expression by RT-PCR and western blot, and established specificity by showing consistent effects across multiple cell lines (MDA-MB-231 and SK-BR-3) . The researchers further validated functional consequences through multiple independent assays (proliferation, colony formation, apoptosis, cell cycle analysis) .

How is NPY5R being investigated as a potential therapeutic target?

NPY5R has emerged as a promising therapeutic target across multiple disease contexts, with ongoing research exploring its potential in metabolic disorders, cancer, and neurological conditions. Current investigations focus on several strategic approaches for therapeutic development.

In metabolic disorders, NPY5R antagonists have been investigated for their potential to suppress appetite and reduce food intake, building on the established role of Y5R in feeding behavior. The selective Y5R agonist [Ala(31),Aib(32)]NPY has been shown to significantly stimulate feeding in rats, confirming the receptor's importance in appetite regulation . Conversely, antagonists could potentially reduce excessive food intake in obesity treatment approaches.

In breast cancer, NPY5R has demonstrated promise as both a diagnostic biomarker and therapeutic target. Research has revealed:

  • NPY5R functions as a tumor suppressor but is frequently downregulated in breast cancer

  • Expression is silenced specifically through promoter methylation, suggesting epigenetic targeting strategies

  • Overexpression of NPY5R inhibits breast cancer cell growth and increases sensitivity to doxorubicin, indicating potential for combination therapy approaches

  • The IL6-STAT3 pathway is implicated in NPY5R-mediated antitumor effects, providing a mechanistic basis for therapeutic development

These findings suggest multiple therapeutic strategies, including:

  • Epigenetic drugs to reverse NPY5R promoter methylation and restore expression

  • Selective NPY5R agonists to activate tumor-suppressive signaling

  • Combination approaches with conventional chemotherapeutics like doxorubicin

  • Targeting of downstream pathways like IL6-STAT3 in NPY5R-deficient tumors

As research progresses, therapeutic applications of NPY5R modulation will likely expand to additional disease contexts where its regulatory roles in cell growth, apoptosis, and metabolic signaling are relevant.

What are the latest techniques for studying NPY5R-ligand interactions?

Advanced techniques for studying NPY5R-ligand interactions are rapidly evolving, providing unprecedented insights into the molecular mechanisms of receptor activation and selectivity. These methodologies span from structural biology approaches to sophisticated functional assays.

Structural biology techniques offer direct visualization of receptor-ligand complexes:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized GPCR structural biology, allowing visualization of receptors in various conformational states with bound ligands. For NPY receptors, this approach can reveal the distinct binding modes that enable selective recognition despite the receptor family's structural diversity

  • NMR solution structure analysis: NMR studies have been used to characterize the solution structures of NPY and related peptides, providing insights into the conformational changes that may occur upon receptor binding

  • Molecular dynamics simulations: Computational approaches can predict ligand binding modes and receptor conformational changes, generating testable hypotheses about structure-activity relationships

Functional and biophysical interaction assays include:

  • Bioluminescence resonance energy transfer (BRET): This technique can measure ligand-induced conformational changes in real-time in living cells, providing insights into the dynamics of NPY5R activation

  • Surface plasmon resonance (SPR): SPR allows measurement of binding kinetics (association and dissociation rates) between purified receptors and ligands, giving detailed information about binding affinity and residence time

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map ligand binding sites and conformational changes by measuring the accessibility of protein regions to solvent

These advanced techniques are complementary to traditional binding assays and provide a more comprehensive understanding of how structural features of both NPY5R and its ligands contribute to binding specificity and functional outcomes.

How does epigenetic regulation, particularly methylation, affect NPY5R expression and function?

Epigenetic regulation of NPY5R has emerged as a critical mechanism controlling its expression in both physiological and pathological contexts. Methylation, in particular, plays a dominant role in silencing NPY5R expression in cancer, with significant implications for diagnostic and therapeutic approaches.

Research on breast cancer has revealed that NPY5R expression is frequently silenced through promoter methylation . Analysis of The Cancer Genome Atlas (TCGA) data showed significantly decreased NPY5R expression in breast tumor tissues compared with tumor-free tissues, which was independently confirmed in multiple Gene Expression Omnibus (GEO) datasets and through immunohistochemistry and qPCR of clinical samples .

The functional consequences of this epigenetic silencing are significant:

  • Loss of tumor-suppressive effects: NPY5R overexpression experiments demonstrated that the receptor inhibits breast cancer cell growth, suggesting that its methylation-induced silencing contributes to cancer progression

  • Altered chemosensitivity: Restoring NPY5R expression enhanced the sensitivity of breast cancer cells to doxorubicin, indicating that epigenetic silencing may contribute to treatment resistance

  • Pathway dysregulation: NPY5R suppression leads to aberrant activation of the IL6-STAT3 pathway, promoting cancer cell survival and proliferation

These findings suggest potential epigenetic therapeutic approaches:

  • DNA methyltransferase inhibitors to reverse NPY5R promoter methylation

  • Histone deacetylase inhibitors to modify the chromatin environment

  • Targeted epigenetic editing using CRISPR-based approaches

Beyond cancer, understanding the epigenetic regulation of NPY5R may have broader implications for conditions where its expression is dysregulated, including metabolic disorders and neurological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.