Recombinant Rat Nucleolar complex protein 4 homolog (Noc4l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Noc4l; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Noc4l
Target Protein Sequence
MERQPASTGSRQELGRLLEAVLSNRGRANAVFDILAVLQSEDPEEIKEGVRTCSRLFGTL LEREELFVGSLPCEDMALAGSQGATYKYKVWMRHRYHSCCNRLEELLTHPSFQVKELALE TLMKFVQLEGAKPLEKPQWESHYLFPRTLFRAVVGGLLTPEDDHSLLISQFCEYLEYDDI RYHAMQVATSILARATSRQPEVSLTFWNNAFTLLSAVNLPLQEHELTNFYVKHAQTSSKW KVVHLKEQRKAFQEMWLGFLKHKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFLTSACDV GGAISLLALNGLFILIHKHNLEYPDFYQRLYGLLDPSIFHVKYRARFFHLADLFLSSSHL PAYLVAAFAKRLARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDP TEKDPARSRALESCLWELQTLQQHYHPEVSRAASVINQALSVPEVSIAPLLELTAYEIFE QDLKKMMPESVPLEFIPAKGLLGRQDDLCTQFFCLS
Uniprot No.

Target Background

Database Links
Protein Families
CBF/MAK21 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Nucleus, nucleolus.

Q&A

What is Noc4l and what are its primary cellular functions?

Noc4l (Nucleolar complex protein 4 homolog) is a homolog of yeast Noc4p, which traditionally was known for its role in ribosome biosynthesis. In yeast, Noc4p forms a stable heterodimer with Nop14p and mediates the maturation and nuclear export of 40S ribosomal subunits . The human NOC4L encodes an approximately 58-KDa protein comprising 516 amino acids and contains a highly conserved Noc domain (residue 416-460 aa) at its C-terminus .

Beyond its classical role in ribosome biogenesis, Noc4l has been discovered to have unexpected functions, particularly in macrophages where it interacts with TLR4 to inhibit its endocytosis and block the TRIF pathway, thereby modulating inflammatory responses . Additionally, Noc4l has been found to interact with SIRT1 to inhibit SIRT1-mediated deacetylation of p53, suggesting a role in tumor suppression and regulation of cell apoptosis .

What is the tissue distribution pattern of Noc4l in mammals?

Noc4l exhibits a specific tissue distribution pattern in mammals. In mice, Noc4l is preferentially expressed in the testis, lung, white adipose tissue (WAT), and various immune organs . Normal tissue RNA-seq data from public databases indicates that in humans, NOC4L is highly expressed in testis, fat, and immune organs . FACS-based full-length transcript analysis has shown that Noc4l is also highly expressed in bone marrow .

Within adipose tissue, double immunofluorescence analyses using NOC4L antibodies alongside macrophage markers (F4/80 or Mac-2) have revealed that NOC4L co-localizes with these markers, indicating predominant expression in adipose tissue macrophages (ATMs) in both mice and humans .

What is the subcellular localization of Noc4l?

Unlike its yeast counterpart Noc4p which localizes to the nucleolus, mammalian Noc4l shows a different cellular distribution. Immunofluorescence studies and experiments with EGFP-tagged NOC4L constructs (both N- and C-terminal fusions) have demonstrated that Noc4l is mainly localized in cytoplasmic granules, particularly in perinuclear membrane granule-like organelles .

This localization pattern was confirmed through multiple approaches:

  • EGFP fusion proteins (EGFP-NOC4L and NOC4L-EGFP) expressed in HeLa cells

  • Recombinant Flag-tagged NOC4L (both N- and C-terminal tags) visualized by immunocytochemistry

  • Direct immunofluorescence using antibodies against NOC4L

Although some faint signals were observed in the nucleus, nuclear localization signal (NLS) prediction programs did not identify an NLS in NOC4L, suggesting that NOC4L may require binding partners with NLS to function in the nucleolus for 18S rRNA processing, similar to yeast Noc4p .

How can Noc4l function be studied in vivo, and what phenotypes are observed in Noc4l knockout models?

Studying Noc4l function in vivo requires multiple complementary approaches due to the embryonic lethality of complete Noc4l knockout. Research has established several experimental models for investigating Noc4l function:

Complete Knockout Model:
Complete deletion of Noc4l leads to embryonic lethality in mice, indicating its essential role in development . This necessitates alternative approaches for studying Noc4l function in adult animals.

Conditional Knockout Models:
Macrophage-specific deletion of Noc4l (Noc4l LKO) has been successfully created using Cre-lox technology. These mice display:

  • No observable abnormalities in kidney, liver, lung, spleen, and eWAT histopathology at 2 months of age

  • Normal body weight when fed a chow diet

  • Increased weight gain compared to control mice when fed a high-fat diet

  • Increased epididymal fat mass on high-fat diet

  • Elevated fasting blood glucose, insulin, free fatty acids, triglycerides, and cholesterol levels

  • Impaired glucose tolerance and insulin sensitivity

  • Decreased oxygen consumption, CO₂ production, and energy expenditure

Overexpression Models:
Two approaches for Noc4l overexpression have been utilized:

  • Lentivirus-mediated overexpression (Lv-Noc4l): Tail intravenous injection of Lv-Noc4l in diet-induced obese mice increases Noc4l expression in liver and WAT after 3 weeks.

  • Transgenic overexpression: Transgenic mice constitutively overexpressing Noc4l.

Both overexpression models demonstrate:

  • Decreased glucose intolerance

  • Improved insulin resistance

  • Reduced total fat mass (including epididymal, inguinal, and perinephric fat)

  • Reduced symptoms of fatty liver

Xenograft Models:
Nude mice xenograft models have been used to demonstrate that NOC4L restrains tumor growth, further supporting its potential tumor suppressor role .

What methodologies are effective for investigating Noc4l's role in inflammation and macrophage polarization?

Investigating Noc4l's role in inflammation and macrophage polarization requires specialized methodologies:

Bone Marrow-Derived Macrophages (BMDMs) Isolation and Polarization:

  • Isolate BMDMs from Noc4l-floxed (Noc4l fl/fl) and macrophage-specific knockout (Noc4l LKO) mice

  • Treat BMDMs with:

    • LPS to promote M1 (pro-inflammatory) polarization

    • IL-4 to promote M2 (anti-inflammatory) polarization

    • Palmitic acid (PA) to mimic fatty acid-induced inflammation

Analysis of Macrophage Polarization Markers:

  • Quantify expression of M1 markers (IL-6, TNFα, MCP1) and M2 markers (Arg1, Mrc1) using qRT-PCR

  • Measure anti-inflammatory cytokines such as IL-10 by qRT-PCR

  • Confirm findings with RNA-seq analysis to identify broader transcriptional changes

In Vivo Inflammation Assessment:

  • Measure serum proinflammatory cytokines (TNFα, IL-6) by ELISA

  • Quantify proinflammatory gene expression in tissues (WAT, liver) by qRT-PCR

  • Assess macrophage infiltration in WAT through:

    • H&E staining for crown-like structures

    • Quantification of macrophage markers (CD68, F4/80) at transcript level

    • Flow cytometry for macrophage populations

Research has shown that Noc4l deficiency promotes M1-like macrophage polarization, with BMDMs from Noc4l LKO mice exhibiting significantly increased responses to LPS stimulation and enhanced expression of proinflammatory cytokines while showing reduced M2 macrophage markers after IL-4 treatment .

What techniques can be employed to investigate Noc4l's protein interactions, particularly with TLR4 and SIRT1?

Noc4l has been shown to interact with at least two important proteins: TLR4 in the context of inflammation regulation and SIRT1 in the context of p53 regulation. Different techniques can be employed to study these interactions:

For Noc4l-TLR4 Interaction:

  • Co-immunoprecipitation (Co-IP) assays using antibodies against Noc4l or TLR4

  • Proximity ligation assay to visualize protein-protein interactions in situ

  • Fluorescence resonance energy transfer (FRET) analysis with fluorescently tagged proteins

  • Domain mapping through deletion constructs to identify interaction domains

  • TLR4 endocytosis assays to assess the functional consequence of Noc4l interaction with TLR4

  • Analysis of downstream signaling molecules in the TRIF pathway

For Noc4l-SIRT1 Interaction:

  • Co-IP assays using antibodies against Noc4l or SIRT1

  • In vitro binding assays with purified recombinant proteins

  • Domain mapping to identify that the C-terminal of NOC4L and the catalytic domain of SIRT1 are required for interaction

  • Functional assays measuring p53 acetylation levels in the presence/absence of Noc4l

  • Analysis of p53 target gene expression using qRT-PCR or reporter assays

Research has established that Noc4l can interact with TLR4 to inhibit its endocytosis, thereby blocking the TRIF pathway and ameliorating inflammation . Similarly, NOC4L has been shown to bind directly to SIRT1 and inhibit SIRT1-mediated deacetylation of p53, leading to increased p53 acetylation and enhanced cell apoptosis .

How does Noc4l expression change in obesity and insulin resistance models?

Noc4l expression shows consistent changes in obesity and insulin resistance models across both human and animal studies. The expression profile and correlation with metabolic parameters are as follows:

Expression Changes in Obesity:

  • Decreased NOC4L mRNA and protein expression in white adipose tissue (WAT) of diet-induced obese (DIO) mice

  • Reduced NOC4L levels in WAT of genetically diabetic mice (db/db)

  • Similarly decreased NOC4L expression in adipose tissue of obese humans

Correlation with Metabolic Parameters:
Analysis of the ATTIE LAB DIABETES DATABASE revealed that among all diabetes-related clinical traits, glucose level was identified as the factor most negatively correlated with Noc4l transcripts. This finding suggests that lower Noc4l expression is associated with higher blood glucose levels .

These consistent observations across multiple obesity models suggest that Noc4l downregulation might be a common feature of obesity-associated metabolic dysfunction, potentially contributing to the development of insulin resistance and low-grade systemic inflammation.

What are the experimental procedures to evaluate Noc4l's impact on glucose homeostasis and insulin sensitivity?

Evaluating Noc4l's impact on glucose homeostasis and insulin sensitivity requires a comprehensive set of in vivo and ex vivo methodologies:

In Vivo Metabolic Testing:

  • Glucose Tolerance Test (GTT):

    • Fast mice for 6-8 hours

    • Measure baseline blood glucose

    • Administer glucose (1-2 g/kg body weight) via intraperitoneal injection

    • Monitor blood glucose at 15, 30, 60, 90, and 120 minutes post-injection

    • Calculate area under the curve (AUC)

  • Insulin Tolerance Test (ITT):

    • Fast mice for 4-6 hours

    • Measure baseline blood glucose

    • Administer insulin (0.75-1 U/kg body weight) via intraperitoneal injection

    • Monitor blood glucose at 15, 30, 60, 90, and 120 minutes post-injection

    • Calculate percentage of initial glucose over time

  • Metabolic Cage Studies:

    • Measure oxygen consumption (VO₂)

    • Quantify carbon dioxide production (VCO₂)

    • Calculate energy expenditure (EE)

    • Monitor food intake and locomotor activity

Biochemical Measurements:

  • Fasting blood glucose measurement

  • Serum insulin quantification by ELISA

  • Measurement of serum free fatty acids (FFAs)

  • Quantification of triglycerides (TGs) and cholesterol (CHOL)

Tissue-Specific Insulin Signaling:

  • Insulin-stimulated phosphorylation of AKT in liver, muscle, and adipose tissue

  • Assessment of insulin receptor substrate (IRS) phosphorylation

  • Analysis of glucose transporter (GLUT4) translocation in adipocytes and muscle cells

These methods have revealed that macrophage-specific deletion of Noc4l leads to impaired glucose tolerance and insulin sensitivity, particularly when mice are challenged with a high-fat diet, while overexpression of Noc4l via lentivirus treatment improves these parameters in diet-induced obese mice .

What mechanisms underlie Noc4l's potential tumor suppressor function?

Noc4l has been identified as a potential tumor suppressor through several mechanistic pathways:

Regulation of p53 Activity:
NOC4L binds to SIRT1, a NAD⁺-dependent deacetylase that is often upregulated in various tumors. This interaction inhibits SIRT1-mediated deacetylation of p53, a critical tumor suppressor protein. Specifically:

p53-Dependent Inhibition of Cell Proliferation:
Experimental evidence shows that NOC4L inhibits tumor cell proliferation specifically in a p53-dependent manner. This suggests that NOC4L's tumor suppressor activity requires functional p53 .

Response to Nucleolar Stress:
NOC4L's interaction with SIRT1 is enhanced under nucleolar stress conditions, indicating that NOC4L may function as part of a cellular stress response system that helps eliminate damaged cells through p53-mediated apoptosis .

How can researchers experimentally assess the impact of Noc4l on tumor growth and progression?

Researchers can employ various experimental approaches to assess Noc4l's impact on tumor growth and progression:

In Vitro Approaches:

  • Cell Proliferation Assays:

    • MTT/MTS assays to measure metabolic activity

    • BrdU incorporation assays to measure DNA synthesis

    • Colony formation assays to assess clonogenic potential

  • Cell Death Assays:

    • Annexin V/PI staining for apoptosis detection

    • TUNEL assay for DNA fragmentation

    • Caspase activity assays

  • Molecular Analyses:

    • Western blotting for p53 acetylation levels

    • qRT-PCR for p53 target gene expression

    • Chromatin immunoprecipitation to assess p53 binding to target genes

In Vivo Approaches:

  • Xenograft Models:

    • Subcutaneous injection of cancer cells with modified Noc4l expression (overexpression or knockdown) into nude mice

    • Regular measurement of tumor volume and weight

    • Histological examination of harvested tumors

  • Genetic Mouse Models:

    • Tissue-specific Noc4l knockout in cancer-prone genetic backgrounds

    • Monitoring of spontaneous tumor development

    • Analysis of tumor initiation, growth, and metastasis

Clinical Correlation:

  • Analysis of NOC4L expression in human cancer samples

  • Correlation of NOC4L expression with:

    • TP53 mutation status

    • Patient survival and prognosis

    • Tumor characteristics (stage, grade, etc.)

Research has shown that colorectal cancer patients with high expression of NOC4L had a better prognosis when TP53 was normally expressed, whereas no significant difference in survival was observed in patients with mutant TP53. This clinical observation supports the laboratory findings that NOC4L's tumor-suppressive effects are p53-dependent .

What are the best approaches for generating and validating recombinant Noc4l protein for functional studies?

Generating and validating recombinant Noc4l protein for functional studies requires careful consideration of expression systems, purification methods, and validation techniques:

Expression Systems:

  • Bacterial Expression (E. coli):

    • Advantages: High yield, cost-effective, fast growth

    • Limitations: May lack proper folding and post-translational modifications

    • Suitable for domain studies or when modifications aren't critical

  • Insect Cell Expression (Baculovirus):

    • Advantages: Better folding, some post-translational modifications

    • Suitable for full-length Noc4l expression with higher activity

  • Mammalian Cell Expression:

    • Advantages: Proper folding and authentic post-translational modifications

    • Suitable for studies requiring fully functional Noc4l

Purification Methods:

  • Affinity Tags:

    • His-tag for IMAC purification

    • GST-tag for glutathione affinity purification

    • FLAG or HA tags for immunoaffinity purification

  • Purification Process:

    • Initial capture using affinity chromatography

    • Further purification using ion exchange chromatography

    • Final polishing step using size exclusion chromatography

Validation Techniques:

  • Physical Characterization:

    • SDS-PAGE to confirm size and purity

    • Western blotting with Noc4l-specific antibodies

    • Mass spectrometry for protein identification and analysis of modifications

  • Functional Validation:

    • In vitro binding assays with known partners (TLR4, SIRT1)

    • SIRT1 deacetylase inhibition assay

    • TLR4 endocytosis assay

Research has validated Noc4l antibodies using NOC4L-Flag vector to overexpress NOC4L and by detecting Noc4l expression in Noc4l-ablated bone-marrow-derived-macrophages (BMDMs), confirming antibody specificity for subsequent experiments .

How can researchers investigate the transcriptional and post-translational regulation of Noc4l expression?

Understanding the transcriptional and post-translational regulation of Noc4l requires multi-layered approaches:

Transcriptional Regulation:

  • Promoter Analysis:

    • Identify the Noc4l promoter region using bioinformatic approaches

    • Generate reporter constructs with the promoter driving luciferase expression

    • Test effects of various transcription factors or cellular conditions

  • Transcription Factor Binding:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the Noc4l promoter

    • Electrophoretic mobility shift assay (EMSA) to confirm binding in vitro

    • ChIP-seq for genome-wide profiling of transcription factor binding sites

  • Epigenetic Regulation:

    • DNA methylation analysis using bisulfite sequencing

    • Histone modification analysis using ChIP with antibodies against specific modifications

    • Effect of HDAC inhibitors or DNA methyltransferase inhibitors on Noc4l expression

Post-Translational Regulation:

  • Protein Stability:

    • Cycloheximide chase assays to determine protein half-life

    • Proteasome inhibitors to assess ubiquitin-dependent degradation

    • Analysis of potential degrons or stability-regulating domains

  • Post-Translational Modifications:

    • Phosphorylation: Phospho-specific antibodies, mass spectrometry, phosphatase treatments

    • Ubiquitination: Immunoprecipitation under denaturing conditions, ubiquitin pull-down assays

    • Other modifications: Acetylation, SUMOylation, etc., using specific antibodies or mass spectrometry

Regulation Under Physiological Conditions:

  • Metabolic Stress:

    • High glucose, insulin, or fatty acid treatments to mimic metabolic stress

    • Analysis of Noc4l mRNA and protein levels under these conditions

  • Inflammatory Stimuli:

    • LPS, TNFα, or IL-1β treatments to assess inflammatory regulation

    • Time-course analysis to determine acute vs. chronic effects

How can Noc4l research findings be translated into potential therapeutic strategies for metabolic disorders?

The research findings on Noc4l suggest several potential therapeutic strategies for metabolic disorders, particularly those characterized by insulin resistance and low-grade inflammation:

Targeting Noc4l Expression:

  • Gene Therapy Approaches:

    • Lentiviral or adeno-associated viral vectors expressing Noc4l, similar to the Lv-Noc4l approach that improved glucose tolerance and insulin sensitivity in diet-induced obese mice

    • Tissue-specific delivery systems targeting adipose tissue or liver

  • Small Molecule Enhancers:

    • Screen for compounds that enhance Noc4l expression or stability

    • Develop drugs that mimic Noc4l function in blocking TLR4 endocytosis

Targeting Noc4l-TLR4 Interaction:

  • Peptide Inhibitors:

    • Design peptides based on the Noc4l-TLR4 interaction interface

    • Develop cell-penetrating peptides that can block TLR4 endocytosis

  • Small Molecule Modulators:

    • Screen for compounds that enhance the Noc4l-TLR4 interaction

    • Develop drugs that directly block TLR4 endocytosis independent of Noc4l

Targeting Downstream Pathways:

  • TRIF Pathway Inhibitors:

    • Develop inhibitors of the TRIF signaling pathway activated by TLR4 endocytosis

    • Target specific mediators downstream of TRIF that contribute to inflammation

Combinatorial Approaches:

  • Combination with existing anti-diabetic drugs

  • Dual-targeting of Noc4l expression and inflammatory pathways

The research showing that overexpression of Noc4l via lentivirus treatment improved glucose metabolism and reduced inflammation in diet-induced obese mice provides proof-of-concept evidence that strategies targeting Noc4l could have therapeutic potential for metabolic disorders .

What are the implications of Noc4l research for cancer diagnosis and treatment approaches?

Noc4l research has several implications for cancer diagnosis and treatment approaches:

Diagnostic Applications:

  • Prognostic Biomarker:

    • NOC4L expression levels could serve as a prognostic biomarker in certain cancers

    • Research has shown that colorectal cancer patients with high NOC4L expression had better prognosis when TP53 was normally expressed

  • Companion Diagnostics:

    • NOC4L expression, together with TP53 mutation status, could help stratify patients for specific treatment approaches

    • This combination could predict responsiveness to p53-activating therapies

Therapeutic Strategies:

  • Enhancing NOC4L Function:

    • Develop approaches to increase NOC4L expression or activity in tumors

    • Design small molecules that mimic NOC4L's inhibitory effect on SIRT1

  • Combination with p53-Activating Therapies:

    • Combine NOC4L-targeting approaches with existing p53-activating drugs

    • Enhance p53 acetylation through both SIRT1 inhibition and other mechanisms

  • Synthetic Lethality Approaches:

    • Identify contexts where NOC4L modulation is selectively lethal to cancer cells

    • Develop combination therapies that exploit vulnerabilities in NOC4L-low tumors

Personalized Medicine Considerations:

  • TP53 Status:

    • NOC4L-based therapies would likely be most effective in tumors with wild-type p53

    • Patients with mutant p53 may require alternative treatment strategies

  • SIRT1 Expression:

    • Tumors with high SIRT1 expression might be particularly sensitive to NOC4L-enhancing strategies

    • Monitoring SIRT1 levels could help identify appropriate patient populations

The finding that NOC4L inhibits tumor cell proliferation in a p53-dependent manner and restrains tumor growth in a nude mice xenograft model provides preclinical evidence supporting the development of NOC4L-based approaches for cancer treatment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.