Recombinant Rat Nucleoporin NDC1 (Tmem48)

Shipped with Ice Packs
In Stock

Description

Mammalian Cell-Expressed (CSB-MP731808RA1)

  • Source: Mammalian cells (e.g., HEK293)

  • Purity: >85% (SDS-PAGE)

  • Tag: Determined during manufacturing (e.g., His-tag, GST)

  • Reconstitution: Deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Recombinant NDC1 is used to study:

NPC Assembly and Nuclear Envelope Dynamics

  • In vitro NE formation assays: NDC1 depletion blocks chromatin-NE fusion and NPC integration .

  • Binding studies: GST pull-down assays confirm interactions with Nup53 and Nup93 .

Disease Mechanisms

DiseaseRole of NDC1Evidence
Non-Small Cell Lung CancerOverexpression promotes proliferation, metastasis, and Wnt/β-catenin signalingKnockdown reduces tumor growth
Cervical CancerDrives cell cycle progression (cyclin B1, CDK1) and inhibits apoptosis (Bcl-2)siRNA silencing suppresses tumorigenesis
Ischemic CardiomyopathyMislocalized nucleoplasmic NDC1 correlates with gene dysregulationOverexpression observed in cardiomyopathy models

Antibody Validation

  • Western Blot: Rabbit pAb (A17727) detects NDC1 at ~76 kDa in human, mouse, and rat lysates .

  • ELISA: Used to quantify NDC1 in biological samples .

Oncogenic Roles

NDC1 overexpression is linked to aggressive cancer phenotypes:

  • Lung Cancer: High TMEM48 mRNA levels correlate with lymph node metastasis and poor survival .

  • Cervical Cancer: Silencing TMEM48 reduces β-catenin signaling and tumor burden .

Cardiovascular and Genetic Disorders

  • Cardiomyopathy: NDC1 mislocalization disrupts NPC-mediated gene regulation .

  • Triple-A Syndrome: Binds ALADIN, anchoring it to NPCs (mutations cause adrenal insufficiency) .

  • Infertility: NDC1 mutations impair interaction with Septin12, a regulator of sperm development .

Comparative Analysis of NDC1 Isoforms

FeatureMammalian-ExpressedE. coli-Expressed**
Post-Translational ModificationsPresent (e.g., phosphorylation)Absent
Biological RelevanceSuitable for functional assaysIdeal for structural studies
CostHigherLower

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ndc1; Tmem48; Nucleoporin NDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ndc1
Target Protein Sequence
MATAASGPCAGGSPRDILWRVLGWRIVTSVVWSVLLLPVCITAFIVFSSIDLFHPIQWLS DSLNEFYSSQVIFYLLLLAVVIIIISIFNVEFYTVVPSIPGSRLALIARILHPQQLTHSF IHAVMGMAVAWCAAIMTKGQSRSLVVPCTGTESLDSPAAQTCMNEYHLFFLLSGAFMGYS YSLLYFINNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFMVRNFCIVYYFFGHIPK AWISTALDLRTDEQAHRPLDTIGGLLNVSLLYHVWLCGVFLLMTWYISWILFKIYATEAY MFPVQPPFAEESDECLPKVLNSNPPLIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHP HNWTAISRECLSLLNDMTQKLVLYQEAAATNGRMYSSYSVEPKRLSSPEETAFQTPKPSQ MPSVPPLVKTSLFSPKLSTPDGSSPFGTPFGSSVVNRMAGIFDVNTCCGSPQSPQLVRRG PRLWTHTSDQQVSAVSNPSPCASVTAEGKTVRQPSVLYSWIQNKREQIKNFLSKRVLIMY FFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQEA VDKYFKLPHASSKPPRTSGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASAE HQKRLQQFLEFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (Tmem48) is a component of the nuclear pore complex (NPC), playing a crucial role in the de novo assembly and insertion of NPCs into the nuclear envelope. It is essential for NPC and nuclear envelope formation, potentially by establishing a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC to the membrane.
Database Links
Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nucleoporin NDC1 (Tmem48) and what is its role in cellular biology?

NDC1 (Transmembrane protein 48 or Tmem48) is a conserved transmembrane nucleoporin that serves as an integral component of the nuclear pore complex. It spans the nuclear envelope and plays a critical role in NPC assembly and anchoring. Initially recognized as a cell cycle modulator in budding yeast, NDC1 was later characterized as a component of the NPC in vertebrates . It functions through interactions with other nucleoporins, particularly Nup53, to facilitate proper NPC formation and anchoring into the nuclear envelope . NDC1 also anchors another nuclear pore protein called ALADIN to the nuclear envelope, with this interaction having implications for certain disease states .

NDC1 is particularly important for maintaining proper nuclear transport functions and nuclear envelope integrity. Studies in C. elegans have demonstrated that NDC1 determines NPC density and influences nuclear size through mechanisms parallel to but distinct from membrane biogenesis pathways .

How does NDC1 interact with other nuclear pore complex components?

NDC1 serves as a critical link between the nuclear membrane and the soluble components of the NPC. Research has identified specific molecular interactions between NDC1 and other nucleoporins:

  • The Nup93-53 Complex: NDC1 interacts directly with Nup53, specifically binding to the C-terminal 26 amino acids of Nup53 . This interaction appears to be specific, as NDC1 does not bind to a C-terminal truncation of Nup53 that lacks these residues.

  • Inner Ring Components: The loss of NDC1 results in reduced NPC association of Nup53, Nup93, and Nup205 as demonstrated by immunofluorescence studies, suggesting that NDC1 helps recruit or stabilize these inner ring components .

  • Outer Scaffold Components: Loss of NDC1 results in faster turnover of the outer scaffold nucleoporin Nup160 at the nuclear envelope, providing an explanation for how NDC1 controls NPC number .

  • Distinct from Other Transmembrane Nucleoporins: Although NDC1 and POM121 co-segregate on the same vesicle populations that bind with high avidity to chromatin, NDC1 does not directly interact with other transmembrane nucleoporins like POM121 or GP210 .

What experimental phenotypes are observed following NDC1 depletion or mutation?

Depletion or mutation of NDC1 leads to several distinct phenotypes that highlight its essential roles:

  • Reduced NPC Density: In C. elegans embryos, NDC1 mutants show approximately 4.8-fold fewer NPCs (11 vs. 55 NPCs/μm²) in reforming nuclear envelopes compared to controls . This indicates a critical role for NDC1 in determining NPC density.

  • Disrupted Nuclear Envelope Formation: In Xenopus egg extract systems, depletion of NDC1 blocks nuclear envelope formation. This phenotype can be rescued by adding back recombinant N- or C-terminally tagged NDC1 .

  • Reduced FG-Nucleoporin Incorporation: RNAi-mediated knockdown of NDC1 in human cells results in decreased staining of mAb414-reactive nucleoporins at the nuclear rim, indicating impaired incorporation of FG-repeat containing nucleoporins .

  • Synthetic Lethality: Nuclear envelope formation completely fails in the absence of both NDC1 and the inner ring component Nup53, suggesting they have partially redundant roles in NPC assembly .

  • Cellular Growth Effects: In contexts beyond its structural role, TMEM48 (NDC1) overexpression in cervical cancer promotes cell proliferation, migration, and invasion both in vitro and in vivo .

What are the optimal storage and handling conditions for recombinant rat NDC1?

For optimal results when working with recombinant rat NDC1, the following storage and handling protocols should be followed:

  • Initial Handling: Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitution: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-Term Storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C . The vendor's default final concentration of glycerol is 50%.

  • Shelf Life: For liquid form, the shelf life is typically 6 months at -20°C/-80°C. For lyophilized form, the shelf life extends to 12 months at -20°C/-80°C .

  • Working Conditions: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

  • Purity Considerations: Commercial recombinant rat NDC1 is typically provided at >85% purity as determined by SDS-PAGE .

What experimental approaches are most effective for studying NDC1 function in nuclear pore assembly?

Several complementary approaches have proven effective in studying NDC1 function:

  • RNAi-Mediated Knockdown: siRNA targeting of NDC1 has been successfully used in human cell lines like HeLa and U2OS to observe effects on NPC assembly. This approach revealed that the impact of NDC1 depletion varies between cell types, with U2OS cells showing a stronger response than HeLa K cells .

  • Electron Microscopy Tomography: 3D analysis of reforming nuclear envelopes using electron tomography allows visualization and quantification of nuclear pore density. This technique revealed that NDC1 mutants in C. elegans contain approximately 4.8-fold fewer pores than controls .

  • In Vitro Nuclear Assembly Systems: Cell-free systems using Xenopus egg extracts provide a powerful approach for studying NDC1 function. NDC1 can be immunodepleted from these extracts and then reconstituted with recombinant protein to assess functional complementation .

  • Protein-Protein Interaction Assays: GST pull-down experiments using immobilized nucleoporins like Nup53 have identified direct interactions with NDC1. For example, GST-Nup53 specifically interacts with rat NDC1 but not with GP210 or POM121 .

  • Genetic Approaches: In model organisms like C. elegans, genetic deletion of NDC1 combined with live imaging has revealed its role in nuclear envelope formation and NPC assembly during embryonic development .

How can researchers distinguish between direct and indirect effects of NDC1 manipulation?

Distinguishing direct from indirect effects of NDC1 manipulation requires sophisticated experimental approaches:

  • Rescue Experiments: The ability of wild-type versus mutant forms of NDC1 to rescue depletion phenotypes can pinpoint which domains and interactions are essential for specific functions. For example, both N- and C-terminally tagged recombinant NDC1 can rescue the effects of NDC1 depletion in Xenopus egg extracts .

  • Combinatorial Depletion Studies: Depleting NDC1 in combination with other nucleoporins can reveal functional relationships. For instance, codepletion of Nup93 and NDC1 results in distorted nuclear morphology and reduced mAb414 staining, while cells treated with combinations of NDC1 and Nup107 siRNAs show unchanged levels of FG-repeat containing nucleoporins .

  • Domain-Specific Interactions: Identifying the specific domains mediating interactions can help distinguish direct effects. For example, NDC1 binds specifically to the C-terminal 26 amino acids of Nup53, and this interaction is lost when these amino acids are deleted .

  • Temporal Resolution Studies: Analyzing the immediate versus long-term consequences of NDC1 depletion can help separate direct effects from compensatory responses. This is particularly important since nuclear envelope assembly is a complex, multi-step process.

  • Parallel Pathway Analysis: Investigating whether membrane biogenesis pathways can compensate for NDC1 loss helps distinguish its specific contributions. Upregulation of membrane synthesis can restore the slow nuclear growth rate resulting from loss of NDC1 but not from loss of Nup53 .

How does NDC1 coordinate with membrane biogenesis to control nuclear envelope formation?

Research in C. elegans has provided insights into the relationship between NDC1 and membrane biogenesis in nuclear envelope formation:

What molecular mechanisms explain the association between NDC1/TMEM48 and cancer progression?

Emerging research has identified TMEM48 (NDC1) as a potential factor in cancer progression, particularly in cervical cancer:

  • Aberrant Expression: TMEM48 is overexpressed in cervical cancer tissues and cell lines compared to normal controls .

  • Functional Effects: Knockdown of TMEM48 significantly inhibits cervical cancer cell proliferation, migration, and invasion in vitro and suppresses cervical cancer cell growth in vivo .

  • Signaling Pathway Involvement: Mechanistically, TMEM48 down-regulation remarkably decreases the protein levels of β-catenin, TCF1 and AXIN2 in cervical cancer cells. This suggests that TMEM48 exerts its promoting effect on cervical cancer progression via activation of the Wnt/β-catenin pathway .

  • Therapeutic Potential: These findings suggest TMEM48 as a promising therapeutic target for cervical cancer treatment, although additional research is needed to fully understand the molecular mechanisms and to develop targeted interventions .

  • Nuclear Transport Connections: Given NDC1's canonical role in nuclear pore complex assembly, its effects on cancer progression may also involve alterations in nucleocytoplasmic transport of key regulatory factors, though this connection requires further investigation.

What experimental contradictions exist in the literature regarding NDC1 function?

Several experimental contradictions exist in the NDC1 literature that warrant further investigation:

  • Cell Type-Specific Effects: The impact of NDC1 depletion varies between cell types. For example, U2OS cells show a stronger response to NDC1 knockdown than HeLa K cells. Western blot analysis revealed that U2OS cells contained less nucleoporins relative to total protein and cytoskeletal markers than HeLa K cells, possibly explaining this differential sensitivity .

  • Functional Redundancy: There are inconsistent findings regarding the degree of functional redundancy between NDC1 and other transmembrane nucleoporins. While NDC1 and POM121 depletion induce similar phenotypes, adding excess recombinant NDC1 to POM121-depleted membranes did not rescue the POM121 depletion phenotype, suggesting non-overlapping functions despite similar consequences when depleted .

  • Species-Specific Differences: The relative importance of NDC1 varies between species, with different phenotypic severities observed in yeast, C. elegans, and mammalian systems. These differences might reflect evolutionary divergence in nuclear pore complex assembly mechanisms.

  • Membrane Domain Specificity: While NDC1 and POM121 are found on the same membrane vesicle population, there are contradictory findings regarding whether they function in the same or distinct subdomains of the nuclear envelope during assembly.

How are advanced imaging techniques enhancing our understanding of NDC1 dynamics during nuclear pore assembly?

Advanced imaging approaches are providing unprecedented insights into NDC1 dynamics:

  • Electron Tomography: 3D electron tomography has been crucial for quantifying NPC density in the presence and absence of NDC1. In C. elegans embryos, this technique revealed that NDC1 mutants contain significantly fewer NPCs (11 vs. 55 per μm²) in reforming nuclear envelopes .

  • Live Cell Imaging: Time-lapse fluorescence microscopy of fluorescently tagged NDC1 allows monitoring of its recruitment during nuclear envelope reformation after mitosis, providing insights into the temporal sequence of NPC assembly.

  • Super-Resolution Microscopy: Techniques like STORM and PALM enable visualization of NDC1 distribution at the nanoscale, potentially revealing subdomains within the nuclear pore complex where NDC1 preferentially localizes.

  • Correlative Light and Electron Microscopy (CLEM): This approach combines the specific labeling of fluorescence microscopy with the high resolution of electron microscopy, allowing researchers to track NDC1 dynamics and then analyze the same cell at ultrastructural resolution.

  • FRAP (Fluorescence Recovery After Photobleaching): By bleaching NDC1-GFP at the nuclear envelope and monitoring recovery, researchers can study the turnover rates of NDC1 within assembled nuclear pores.

What protein engineering approaches might enhance the utility of recombinant NDC1 for research applications?

Several protein engineering strategies could improve recombinant NDC1 as a research tool:

  • Domain-Specific Constructs: Generating truncated versions of NDC1 containing specific functional domains could facilitate studies of domain-specific interactions and functions.

  • Split-Protein Complementation Systems: Creating fragments of NDC1 that can reconstitute function when brought together could enable studies of NDC1 assembly into the NPC in real-time.

  • Site-Specific Labeling: Introducing unnatural amino acids or specific labeling sites could allow for precise fluorescent or affinity tagging without disrupting function.

  • Stabilized Variants: Engineering increased stability through rational mutations or directed evolution could enhance the shelf-life and experimental utility of recombinant NDC1.

  • Inducible Interaction Domains: Incorporating domains that respond to light or small molecules could enable precise temporal control of NDC1 function in experimental systems.

  • Optimized Expression Systems: Developing improved heterologous expression systems specifically optimized for transmembrane nucleoporins could increase yield and purity of functional recombinant NDC1.

What are the comparative effects of NDC1 depletion across different experimental systems?

Experimental SystemPhenotypic Effects of NDC1 DepletionNPC Density ChangeReference
HeLa K cellsReduced mAb414 staining at nuclear rimModerate decrease
U2OS cellsStronger reduction in mAb414 stainingSignificant decrease
C. elegans embryosFewer NPCs in reforming nuclear envelope4.8-fold reduction (11 vs 55 NPCs/μm²)
Xenopus egg extractsBlock to nuclear envelope formationSevere reduction
Double NDC1/Nup53 depletionComplete failure of nuclear envelope formationNear complete loss
Double NDC1/POM121 RNAiHigh percentage of cells with small nucleiModerate decrease

This comparative data reveals that while NDC1 depletion consistently affects NPC assembly across systems, the severity varies significantly. The strongest effects are observed in in vitro systems like Xenopus egg extracts and in double depletion experiments, suggesting partial functional redundancy with other nucleoporins in intact cells.

What verified molecular interactions have been documented for NDC1?

Interaction PartnerBinding RegionFunctional SignificanceDetection MethodReference
Nup53C-terminal 26 amino acids of Nup53Critical for NPC assemblyGST pull-down from rat liver NE extracts
Nup93-53 ComplexNot specifically determinedLinks transmembrane nucleoporins to soluble nucleoporinsRNAi and immunofluorescence
ALADINNot specifically determinedAnchoring ALADIN to nuclear envelopeProtein interaction studies
Membrane vesiclesTransmembrane domainsHigh avidity chromatin bindingMembrane flotation assays

These verified interactions provide a molecular framework for understanding NDC1's role in nuclear pore complex assembly and function. The specific interaction with Nup53 appears particularly important, as it links the transmembrane domain of the NPC to inner ring components.

What key experimental protocols have been validated for studying NDC1 function?

  • RNAi-mediated knockdown of NDC1 in human cells:

    • siRNA transfection using standard lipid-based transfection reagents

    • Validation by Western blotting with anti-NDC1 antibodies

    • Phenotypic analysis by immunofluorescence with mAb414 antibody to detect FG-repeat nucleoporins

    • Quantification of nuclear envelope staining intensity

  • In vitro nuclear assembly assays:

    • Xenopus egg extract system with immunodepletion of NDC1

    • Addition of recombinant NDC1 (both N- and C-terminally tagged versions functional)

    • Quantification of closed nuclear envelope formation (reduced from 83% in controls to 11% in NDC1-depleted samples)

    • Restoration of function with recombinant NDC1 (61-71% closed nuclear envelope formation)

  • Electron microscopy for NPC quantification:

    • 3D analysis of serial sections from electron tomograms

    • Classification of NE gaps <100 nm as potential NPCs

    • Quantification of NPC density per μm²

    • Comparison between wild-type (55 NPCs/μm²) and NDC1 mutants (11 NPCs/μm²)

  • GST pull-down assays for interaction studies:

    • Immobilization of purified recombinant GST-Nup53 constructs on glutathione Sepharose

    • Incubation with rat liver nuclear envelope extracts containing solubilized nucleoporins

    • Western blot analysis of bound fractions showing specific interaction between GST-Nup53 and rat NDC1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.