Recombinant Rat Olfactory receptor 1073 (Olr1073)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Olr1073; Olfactory receptor 1073; Putative gustatory receptor PTE45
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1073
Target Protein Sequence
MKQQNDTQILQFLLLGLSENTELQPLIYWLFFSMYLVTVWGNLIIILATVLDFRLHTAMY FFLCNLSFVDICLISTTIPKMLANVHLNHKAITYEGCIMQIYFFTLFVGLDNFLLAVMAY DRFVAICHPLRYTSIMTPHLCMSLVLVSWIASVLNSSLQSFLVLQLSFCTEVEIPHFFCE LSMLVHLACSDTFLSDMAMNVLAALLGGGCLVGILYSYSKIVSSIQAISSAEGKYKAFST CVSHLSVVSLFYCTLLGVYLSSAVTQNSHSTAATSLMYTVVTPMLNPFIYSLRNDNIKRA LKNFVKKKLEK
Uniprot No.

Target Background

Function
Possible taste receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Tongue specific.

Q&A

What expression systems are commonly used for producing recombinant Olr1073?

Several expression systems have been documented for the production of recombinant Olr1073, each with distinct advantages depending on the research application:

Expression SystemTag OptionsProduct FormApplicationReference
E. coliHisLyophilized powderSDS-PAGE
Mammalian CellsHisLiquid or lyophilizedVarious
HEK293His (Fc)-Avi-taggedNot specifiedVarious

For functional studies, mammalian expression systems are generally preferred as they provide more appropriate post-translational modifications and membrane insertion. E. coli systems typically yield higher protein quantities but may lack proper folding for functional studies .

The methodology for successful expression includes optimization of codon usage for the host system, careful consideration of fusion tags for purification, and temperature control during induction .

How should recombinant Olr1073 be stored and handled for optimal stability?

Proper storage and handling of recombinant Olr1073 is critical for maintaining protein integrity and functionality. Based on established protocols, the following guidelines are recommended:

For lyophilized powder:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

For liquid preparations:

  • Short-term storage: +4°C

  • Long-term storage: -20°C to -80°C

  • Buffer composition significantly affects stability (typically PBS-based buffers with 6% Trehalose, pH 8.0)

Experimental evidence indicates that repeated freezing and thawing should be avoided, as it leads to significant loss of protein activity. Working aliquots maintained at 4°C remain stable for approximately one week .

What methodologies are most effective for studying Olr1073 ligand binding properties?

Studying ligand binding properties of olfactory receptors like Olr1073 requires specialized techniques that can detect the often weak and transient interactions between odorants and receptors. Several methodological approaches have proven effective:

Calcium Imaging

This technique measures changes in intracellular calcium concentration upon receptor activation. For olfactory receptors, this method has been successfully employed with other receptors such as OR17-40 and rat I7 :

  • Express Olr1073 in heterologous systems (preferably HEK293 cells)

  • Load cells with calcium-sensitive fluorescent dyes

  • Expose to potential ligands and monitor fluorescence changes

  • Calculate EC50 values (concentration needed for 50% activation)

Electrophysiological Recordings

For electrophysiological studies of olfactory receptors, the Xenopus oocyte expression system coupled with a "reporter" channel has proven effective:

  • Inject oocytes with Olr1073 cRNA along with appropriate G-protein subunits

  • Co-express with a cAMP-sensitive ion channel as a reporter

  • Apply test odorants and measure conductance changes using voltage-clamp techniques

  • Calculate relative response as normalized conductance during odorant application compared to control

Computational Modeling and Docking

Computational approaches based on homology modeling have been valuable for predicting olfactory receptor binding sites:

  • Generate a homology structural model of Olr1073 using the crystal structure of bovine visual rhodopsin (or newer GPCR structures) as a template

  • Apply molecular docking algorithms to predict binding of candidate ligands

  • Calculate binding free energies using methods such as FEP (Free Energy Perturbation)

  • Validate computational predictions with experimental measurements

How can genetic tools be optimized for studying Olr1073 function?

RNA interference (RNAi) techniques provide valuable tools for studying Olr1073 function through selective gene knockdown. Commercially available shRNA plasmids contain multiple target-specific constructs encoding 19-23 nucleotide shRNAs designed to knock down Olr1073 expression . For optimal results:

  • Plasmid preparation:

    • Resuspend lyophilized shRNA plasmid DNA in 500 μL of deionized water

    • Each vial typically contains 50 μg, sufficient for approximately 50 transfections

  • Transfection optimization:

    • For olfactory sensory neurons, electroporation or viral vector delivery methods are recommended

    • Adenoviral vectors have been successfully used to express recombinant olfactory receptors in rat olfactory sensory neurons

  • Validation methods:

    • Confirm knockdown efficiency using qRT-PCR

    • Assess protein reduction via Western blot or immunocytochemistry

    • Functional validation through calcium imaging or electrophysiological recordings

  • Control considerations:

    • Include scrambled shRNA sequences as negative controls

    • Consider rescue experiments with shRNA-resistant Olr1073 constructs

What approaches are effective for integrating Olr1073 research into multi-omics studies?

Integrating Olr1073 research into multi-omics frameworks provides comprehensive insights into olfactory function. Based on current methodologies, effective approaches include:

Transcriptomic Analysis

RNA-Seq and microarray studies have successfully identified differential expression of olfactory receptors including Olr1073 under various conditions:

  • Sample preparation:

    • Isolate RNA from olfactory epithelium or single olfactory sensory neurons

    • Ensure high RNA integrity (RIN > 8.0) for reliable results

  • Data analysis considerations:

    • Apply specialized normalization methods accounting for single-cell variability

    • Use array quality weights in the analysis of microarray data

    • Implement specific bioinformatic pipelines for GPCR identification

  • Validation strategies:

    • Confirm expression patterns with RT-PCR

    • Use in situ hybridization to localize expression within the olfactory epithelium

Functional Genomics Integration

The correlation between genomic, transcriptomic, and functional data provides deeper insights:

  • Optical imaging techniques:

    • Record glomerular responses in the olfactory bulb using intrinsic signal imaging

    • Correlate activity patterns with receptor expression

  • Experimental design considerations:

    • Use concentration series of odorants to determine sensitivity thresholds

    • Account for bilateral symmetry in glomerular responses

    • Apply quantitative formalism for ligand binding to interpret concentration-dependent responses

How can the specificity and sensitivity of Olr1073 be compared to other olfactory receptors?

Understanding the relative specificity and sensitivity of Olr1073 compared to other olfactory receptors requires systematic comparative analysis:

Comparative Receptor Studies

  • Methodology for receptor comparison:

    • Express multiple receptors (Olr1073 and comparators) under identical conditions

    • Test against standardized odorant panels at multiple concentrations

    • Generate response profiles using calcium imaging or electrophysiology

    • Calculate EC50 values for quantitative comparison

  • Notable reference receptors:

    • SR1 (MOR256-3/Olfr124) - Known for unusually broad response profiles

    • Rat I7 - Well-characterized for discriminating saturated aldehydes

    • OR17-40 (human) - First human olfactory receptor functionally expressed in heterologous systems

Tuning Curve Analysis

Quantitative analysis of receptor tuning curves reveals specificity patterns:

  • Generate concentration-response curves for multiple ligands

  • Apply mathematical models of receptor-ligand interactions:

    • Fit data to Hill equation for cooperativity assessment

    • Calculate effective affinity for each ligand

    • Develop an affinity spectrum to characterize receptor sensitivity

  • Assess tuning breadth using statistical measures:

    • Shannon entropy or lifetime sparseness metrics

    • Compare with broadly tuned receptors like SR1, which responds to many structurally unrelated odorants

What are the challenges and solutions in topographical mapping of Olr1073 expression in the olfactory system?

Mapping the topographical distribution of Olr1073-expressing neurons presents several methodological challenges:

Challenges in Anatomical Localization

  • Low expression levels:

    • Individual olfactory receptors typically expressed in <1% of olfactory sensory neurons

    • Signal amplification techniques required for detection

  • Receptor specificity:

    • Cross-reactivity of antibodies against similar olfactory receptors

    • Limited availability of Olr1073-specific antibodies

Methodological Solutions

  • Optical imaging of intrinsic signals:

    • Can monitor approximately 400 glomeruli simultaneously in the rat olfactory bulb

    • Provides spatial resolution to distinguish individual glomeruli

    • Enables correlation of receptor expression with functional activation

  • Histological techniques:

    • Cytochrome oxidase staining to identify glomerular boundaries

    • Alternating sections for different histological stains (cresyl violet and cytochrome oxidase)

    • In situ hybridization with Olr1073-specific probes

  • Functional mapping:

    • Record responses to odorant panels known to activate Olr1073

    • Create spatial maps of glomerular activation

    • Use computational algorithms to integrate functional and anatomical data

What future research directions could advance our understanding of Olr1073?

Based on current knowledge gaps and methodological advances, several promising research directions emerge:

  • Structural biology approaches:

    • Cryo-EM studies of Olr1073 in complex with ligands

    • Advanced computational modeling using AlphaFold2 or similar AI-driven structure prediction tools

  • In vivo functional analysis:

    • CRISPR-based genetic tagging of Olr1073-expressing neurons

    • Optogenetic manipulation of Olr1073 neurons to study behavioral outputs

    • In vivo imaging of Olr1073 neuron activity during odorant exposure

  • Comparative evolutionary studies:

    • Analysis of Olr1073 orthologs across species

    • Investigation of selective pressures on olfactory receptor genes

    • Comparison with the 81 orthologous genes conserved among rodent species and 147 conserved genes within Muroid rodents

  • Development of Olr1073-specific tools:

    • Generation of highly specific antibodies

    • Design of Olr1073-selective agonists and antagonists

    • Creation of reporter lines for real-time visualization of Olr1073 activation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.