Recombinant Rat Olfactory receptor 1078 (Olr1078)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olr1078; Olfactory receptor 1078; Olfactory receptor-like protein F3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1078
Target Protein Sequence
MDSSNRTRVSEFLLLGFVENKDLQPLIYGLFLSMYLVTVIGNISIIVAIISDPCLHTPMY FFLSNLSFVDICFISTTVPKMLVNIQTQNNVITYAGCITQIYFFLLFVELDNFLLTIMAY DRYVAICHPMHYTVIMNYKLCGFLVLVSWIVSVLHALFQSLMMLALPFCTHLEIPHYFCE PNQVIQLTCSDAFLNDLVIYFTLVLLATVPLAGIFYSYFKIVSSICAISSVHGKYKAFST CASHLSVVSLFYCTGLGVYLSSAANNSSQASATASVMYTVVTPMVNPFIYSLRNKDVKSV LKKTLCEEVIRSPPSLLHFFLVLCHLPCFIFCY
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

KEGG: rno:299593

UniGene: Rn.120045

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Olfactory epithelium.

Q&A

What is Olfactory receptor 1078 (Olr1078) and what is its significance in research?

Olfactory receptor 1078 (Olr1078), also known as Olfactory receptor-like protein F3, is a G protein-coupled receptor expressed in rats (Rattus norvegicus). It belongs to the larger family of olfactory receptors (ORs) that were traditionally associated exclusively with olfaction but are now recognized to have broader physiological functions. Olr1078 is particularly significant in research because it represents the expanding understanding of ORs as having system-wide expression and function beyond just smell detection .

The significance of studying Olr1078 extends to understanding extranasal functions of olfactory receptors. Research has demonstrated that ORs similar to Olr1078 can be expressed in tissues including the brain, heart-related systems, and gastrointestinal tract. For example, the related receptor Olfr78 has been shown to be highly expressed in oxygen-sensitive glomus cells of the carotid body, where it may function as a hypoxia sensor in the breathing circuit . These discoveries suggest Olr1078 may have similarly important physiological roles beyond traditional olfaction.

How is recombinant Olr1078 produced and what expression systems are available?

Recombinant Olr1078 can be produced using multiple expression systems, with the two primary platforms being E. coli and mammalian cell expression systems. Each system offers distinct advantages for different research applications:

E. coli expression system: The bacterial expression system (identified in product code CSB-EP338504RA1) provides a cost-effective and relatively high-yield method for producing recombinant Olr1078 . This system is particularly suitable for applications requiring larger protein quantities or for structural studies where post-translational modifications are less critical.

Mammalian cell expression system: Alternatively, mammalian expression systems (identified in product code CSB-MP338504RA1) offer production of Olr1078 with more native-like post-translational modifications and protein folding . This system is preferred for functional studies where receptor activity and proper protein conformation are essential.

Both expression systems typically yield recombinant Olr1078 with >85% purity as determined by SDS-PAGE analysis . The choice between these systems should be guided by the specific requirements of the research question being investigated.

What are the optimal storage conditions for recombinant Olr1078?

The optimal storage conditions for recombinant Olr1078 depend on both the formulation (liquid vs. lyophilized) and the intended duration of storage. Based on standardized protein handling protocols:

  • Long-term storage:

    • Liquid formulations should be stored at -20°C/-80°C, with an expected shelf life of approximately 6 months

    • Lyophilized formulations can be stored at -20°C/-80°C with an extended shelf life of approximately 12 months

  • Working aliquots:

    • Store at 4°C for up to one week

    • Repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity

For optimal stability, recombinant Olr1078 should be reconstituted and stored with 5-50% glycerol (final concentration) when prepared for long-term storage. The recommended default glycerol concentration is 50% for maximum stability .

How should researchers properly reconstitute recombinant Olr1078?

Proper reconstitution of recombinant Olr1078 is critical for maintaining protein integrity and functionality. The recommended protocol involves:

  • Initial preparation: Briefly centrifuge the vial prior to opening to bring contents to the bottom of the container

  • Reconstitution medium: Use deionized sterile water as the reconstitution medium

  • Concentration: Prepare to a final concentration of 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquoting: Divide into smaller working volumes to avoid repeated freeze-thaw cycles

This methodology ensures optimal protein stability while minimizing degradation that could compromise experimental results.

How do olfactory receptors like Olr1078 function in non-olfactory tissues?

Olfactory receptors, including those similar to Olr1078, exhibit diverse functions in non-olfactory tissues through tissue-specific signaling mechanisms. In the case of similar receptors like Olfr78, expression has been detected in oxygen-sensitive glomus cells of the carotid body where it appears to function as a hypoxia sensor in breathing regulation . This expands our understanding of ORs beyond conventional olfactory roles.

Research methodologies for investigating these extranasal functions include:

  • Single-cell RNA-Seq analysis: This approach has been successfully employed to eliminate contamination from other cell types and precisely analyze OR expression in specific cells. Zhou et al. applied this technique to identify Olfr78 as the most highly abundant OR in carotid body glomus cells in mice .

  • Tissue-specific expression profiling: Northern analysis has revealed that the homolog of PSGR (Olfr78) is predominantly expressed in colon, suggesting gastrointestinal functions for some ORs .

  • Functional validation studies: Techniques such as amperometric detection using calcium imaging have been employed to validate OR functionality in non-olfactory tissues .

Understanding Olr1078's potential extranasal functions requires application of these advanced techniques to characterize both expression patterns and functional responses in diverse tissue types.

What molecular modeling approaches can predict ligand binding to Olr1078?

Molecular modeling approaches provide valuable insights into receptor-ligand interactions for olfactory receptors like Olr1078. Based on established methodologies used for similar ORs, the following approach can be adapted:

  • Homology modeling: Construct a molecular model of Olr1078 based on structural templates such as rhodopsin (as was done for OR-I7). The rhodopsin template at 7.5 Å resolution has been successfully used to predict OR structure .

  • Binding pocket identification: Automated computational tools can identify potential binding pockets, typically located approximately 10 Å from the extracellular surface, similar to the position observed in beta-adrenergic receptors .

  • Automated docking: Use molecular docking software to predict interaction sites for potential ligands. For instance, in OR-I7 studies, this approach identified that a lysine on TM4 and an aspartate on TM5 interacted with the aldehyde moiety of octanal .

  • Validation through mutation predictions: Test the model by predicting the effects of amino acid substitutions on ligand binding, which can then be experimentally validated .

This systematic approach provides a framework for predicting Olr1078-ligand interactions that can guide subsequent experimental validation studies.

How can site-directed mutagenesis be applied to study Olr1078 ligand binding?

Site-directed mutagenesis represents a powerful approach for investigating the structural determinants of receptor-ligand interactions in Olr1078. Based on successful applications with similar olfactory receptors, a methodological approach would include:

  • Target residue identification: Use molecular modeling to identify key amino acids likely involved in ligand binding. For example, studies with OR-I7 identified critical lysine and aspartate residues on transmembrane domains TM4 and TM5 that interact with aldehyde moieties .

  • Systematic mutation design: Create a series of single amino acid substitutions targeting:

    • Charged residues potentially forming ionic interactions with ligand functional groups

    • Hydrophobic residues likely forming Van der Waals contacts with hydrocarbon portions of ligands

    • Residues in predicted binding pocket regions approximately 10 Å from the extracellular surface

  • Expression system selection: Express mutated receptors in a heterologous system that allows functional testing, such as HEK293 cells with calcium imaging capabilities or Xenopus oocytes with electrophysiological recording.

  • Functional characterization: Assess changes in ligand binding affinity, activation potency, or specificity through dose-response curves comparing wild-type and mutant receptors.

  • Structural interpretation: Map functional data back to the molecular model to refine understanding of binding pocket architecture.

This methodology provides mechanistic insights into the molecular basis of Olr1078 ligand selectivity and receptor activation.

What research methodology approaches are most appropriate for Olr1078 studies?

The choice of research methodology for Olr1078 studies should be guided by the specific research objectives and available resources. Two primary approaches can be considered:

Qualitative Methodology:

  • Suitable when research aims are exploratory, such as investigating novel functions of Olr1078

  • Involves collecting descriptive data through techniques like immunohistochemistry for visualization of receptor localization

  • Typically employs smaller sample sizes with more detailed analysis

  • Provides rich contextual understanding of Olr1078 biology

Mixed-Method Approach:

  • Often most powerful for Olr1078 research, combining quantitative measurements with qualitative observations

  • Quantitative data provides statistical rigor while qualitative adds mechanistic insights

  • Creates a comprehensive understanding of both "what" and "why" in Olr1078 function

The selection between these methodologies should consider factors including research objectives, required statistical significance, nature of the research (exploratory vs. confirmatory), available sample size, and time constraints .

How should data tables be designed for Olr1078 research experiments?

Properly designed data tables are essential for clearly communicating experimental results in Olr1078 research. The following methodological approach ensures effective data presentation:

  • Variable identification: Clearly identify independent variables (e.g., ligand concentration, mutation type) and dependent variables (e.g., receptor activation, binding affinity) that will be measured4.

  • Table structure: Organize with independent variables in the leftmost column and dependent variables in subsequent columns. For Olr1078 binding studies, this might include ligand types or concentrations as rows with binding parameters as columns.

  • Unit specification: Always include appropriate units of measurement (e.g., nM for binding affinity, % for receptor activation)4.

  • Replication representation: Include both individual trial data and statistical summaries (mean, standard deviation) when multiple experimental replicates are performed.

  • Visual clarity: Ensure the table is visually appealing with consistent formatting, appropriate spacing, and clear headings4.

Example Data Table Format for Olr1078 Ligand Binding Studies:

LigandConcentration (μM)Binding Affinity (nM) Mean ± SDReceptor Activation (% of max) Mean ± SDn
Ligand A1025.3 ± 3.287.5 ± 5.25
Ligand A1125.6 ± 10.545.2 ± 3.85
Ligand B1052.8 ± 6.462.3 ± 7.15
Ligand B1235.9 ± 28.322.8 ± 4.95

This format ensures data is presented in a logical, accessible manner that facilitates interpretation and comparison across experimental conditions4.

What controls should be included in Olr1078 functional studies?

Robust experimental design for Olr1078 functional studies requires comprehensive controls to ensure valid and interpretable results. The following control categories should be incorporated:

1. Expression System Controls:

  • Untransfected cells (negative control)

  • Cells expressing a different, well-characterized olfactory receptor (comparative control)

  • Cells expressing Olr1078 with a known inactivating mutation (non-functional receptor control)

2. Ligand Application Controls:

  • Vehicle-only application (solvent control)

  • Known olfactory receptor ligands that should not activate Olr1078 (specificity control)

  • Positive control ligand if any known activators exist for Olr1078 or closely related receptors

3. Signal Transduction Controls:

  • Direct G-protein activators (e.g., aluminum fluoride) to confirm downstream signaling functionality

  • Pathway inhibitors to validate signaling mechanism (e.g., U73122 for PLC inhibition)

4. Data Analysis Controls:

  • Normalization standards for comparing across experiments

  • Internal standards for quantifying relative responses

5. Biological Variability Controls:

  • Multiple biological replicates (different batches of transfected cells)

  • Technical replicates within each biological replicate

Implementing this comprehensive control strategy ensures that observed effects can be specifically attributed to Olr1078 activity rather than artifacts or non-specific effects, providing the methodological rigor required for high-quality research.

How should dose-response data for Olr1078 be analyzed and presented?

Dose-response analysis for Olr1078 requires rigorous analytical approaches to accurately characterize receptor pharmacology. The recommended methodological framework includes:

  • Data normalization: Normalize raw response data (calcium flux, cAMP levels, etc.) to appropriate controls:

    • Minimum response (vehicle control)

    • Maximum response (positive control if available)

    • Express as percentage of maximum response or fold change over baseline

  • Curve fitting: Apply nonlinear regression analysis using a four-parameter logistic equation:

    Y=Bottom+(TopBottom)1+10(LogEC50X)×Hill SlopeY = Bottom + \frac{(Top - Bottom)}{1 + 10^{(LogEC_{50} - X) \times Hill\ Slope}}

    Where Y is the response, X is the logarithm of concentration, EC₅₀ is the concentration producing 50% response, and Hill Slope describes the steepness of the curve.

  • Parameter extraction: Determine key pharmacological parameters:

    • EC₅₀ (potency)

    • Emax (efficacy/maximum response)

    • Hill coefficient (cooperativity)

  • Statistical analysis: Compare parameters across experimental conditions using appropriate statistical tests (t-test for two conditions, ANOVA for multiple conditions).

  • Graphical presentation: Present data in semi-logarithmic plots with:

    • X-axis: Log concentration of ligand

    • Y-axis: Normalized response

    • Error bars representing SEM or SD

    • Fitted curve with 95% confidence intervals

This methodological approach ensures rigorous characterization of Olr1078 pharmacology while facilitating comparison with other receptors and across experimental conditions.

What statistical approaches are appropriate for comparing Olr1078 expression across tissues?

Analyzing Olr1078 expression across different tissues requires careful selection of statistical methods appropriate for the data type and experimental design. The recommended methodological approach includes:

  • Data normalization:

    • Normalize expression data to appropriate housekeeping genes (e.g., GAPDH, β-actin)

    • Apply log transformation if data is not normally distributed

  • Exploratory data analysis:

    • Generate box plots or violin plots to visualize expression distribution across tissues

    • Conduct normality tests (Shapiro-Wilk) to determine appropriate parametric or non-parametric analysis

  • Statistical comparison methods:

    • For normally distributed data: One-way ANOVA followed by post-hoc tests (Tukey's HSD for all pairwise comparisons or Dunnett's test when comparing to a control tissue)

    • For non-normally distributed data: Kruskal-Wallis test followed by Dunn's multiple comparison test

  • Advanced analysis for complex designs:

    • Two-way ANOVA when examining effects of multiple factors (e.g., tissue type and physiological state)

    • Mixed-effects models when handling repeated measures or hierarchical data

  • Multiple testing correction:

    • Apply Benjamini-Hochberg procedure to control false discovery rate when making numerous comparisons

    • Report both raw and adjusted p-values for transparency

This comprehensive statistical approach ensures robust comparison of Olr1078 expression patterns while controlling for common pitfalls in gene expression analysis.

What emerging technologies could advance Olr1078 research?

The field of olfactory receptor research, including studies of Olr1078, stands to benefit from several emerging technologies that could overcome current methodological limitations:

  • Cryo-electron microscopy: While most OR structural models rely on homology modeling based on rhodopsin templates , direct structural determination of Olr1078 through cryo-EM could provide unprecedented insights into binding pocket architecture and activation mechanisms.

  • Designer receptors exclusively activated by designer drugs (DREADDs): Adapting DREADD technology to Olr1078 could allow precise temporal control of receptor activity in specific tissues, enabling investigation of physiological roles beyond olfaction.

  • Single-cell multi-omics: Integration of transcriptomic, proteomic, and metabolomic data at single-cell resolution could provide comprehensive understanding of Olr1078 expression and function in heterogeneous tissues like the carotid body, building upon previous single-cell RNA-Seq approaches .

  • In vivo optogenetics combined with receptor expression: Coupling Olr1078 activation to light-sensitive modules could enable precise temporal control of receptor activity in living animals, allowing direct examination of physiological responses.

  • AI-driven ligand discovery: Machine learning approaches trained on existing OR-ligand interaction data could accelerate identification of novel Olr1078 ligands and help characterize its functional role in extranasal tissues.

These emerging technologies promise to overcome current limitations in studying the structure, function, and physiological roles of Olr1078, potentially revealing unexpected functions in health and disease.

How might Olr1078 research contribute to understanding broader physiological systems?

Research on Olr1078 has significant potential to contribute to our understanding of multiple physiological systems beyond olfaction, following the paradigm established by related receptors:

  • Respiratory regulation: Given that the related receptor Olfr78 functions as a hypoxia sensor in the carotid body , Olr1078 might play similar roles in oxygen sensing or respiratory control circuits.

  • Gastrointestinal function: Multiple ORs have been detected in enterochromaffin cells of the human gut, suggesting potential roles in chemosensation, nutrient detection, or hormone secretion . Studies of Olr1078 expression and function in digestive tissues could reveal similar roles.

  • Cardiovascular regulation: The expression of ORs in cardiac tissue suggests potential roles in heart function or blood pressure regulation that remain to be fully characterized.

  • Neurodevelopmental processes: Understanding how Olr1078 and similar receptors function in neural tissues outside the olfactory system could provide insights into neurodevelopmental mechanisms and potential therapeutic targets.

  • Metabolic sensing: The ability of some ORs to detect metabolites suggests potential roles for Olr1078 in metabolic regulation, possibly linking environmental chemical sensing with physiological adaptations.

This broader perspective on Olr1078 function reflects the emerging understanding that olfactory receptors constitute a much more diverse sensing system than previously appreciated, with wide-ranging implications for physiology and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.