Recombinant Rat Olfactory receptor 1082 (Olr1082)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Biochemical Profile

The recombinant Olr1082 is expressed in E. coli and modified for enhanced stability and detection.

AspectSpecificationSource
Expression HostE. coli
TagN-terminal 10× His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles
Shelf Life6 months (liquid), 12 months (lyophilized)

3.1. Olfactory Signaling

Olr1082, like other olfactory receptors, binds odorants to activate G-protein-mediated signaling cascades. While specific ligand affinities for Olr1082 remain unstudied, general mechanisms include:

  • Interaction with odorant molecules via transmembrane domains.

  • Coupling to Gαolf proteins to trigger cAMP production or calcium influx .

3.2. Experimental Uses

ApplicationDetailsSource
SDS-PAGEUsed to confirm protein integrity and purity
ELISACommercial kits available for antibody-based quantification
Trafficking StudiesRequires accessory proteins like RTPs for proper membrane localization

4.1. Receptor Trafficking

  • RTP Dependence: Olfactory receptors often require receptor transporters (e.g., RTP1/2) for ER-to-plasma membrane trafficking. While not explicitly tested for Olr1082, studies on analogous rat receptors suggest similar dependencies .

  • Heterologous Expression Challenges: Undifferentiated cells (e.g., CHO) retain olfactory receptors in the ER, necessitating specialized systems (e.g., odora cells) for functional expression .

4.2. Functional Reconstitution

  • Adenoviral-mediated expression in olfactory epithelia enables odorant-induced calcium responses, validating receptor functionality .

  • Ligand specificity is typically determined via single-cell Ca²⁺ imaging or PCR-based cloning .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please include this information in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of the specified tag.
Synonyms
Olr1082; Olfactory receptor 1082; Olfactory receptor-like protein F12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1082
Target Protein Sequence
MESGNSTRRFSSFFLLGFTENPQLHFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPM YFFLANLSFVDICFTSTTIPKMLVNIYTQSKSITYEDCISQMCVFLVFAELGNFLLAVMA YDRYVAXCHPLCYTVIVNHRLCILLLLLSWVISIFHAFIQSLIVLQLTFCGDVKIPHFFC ELNQLSQLTCSDNFPSHLIMNLVPVMLAAISFSGILYSYFKIVSSIHSISTVQGKYKAFS TCASHLSIVSLFYSTGLGVYVSSAVVQSSHSAASASVMYTVVTPMLNPFIYSLRNKDVKR ALERLLEGNCKVHHWTG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Olfactory epithelium.

Q&A

What is Recombinant Rat Olfactory Receptor 1082 (Olr1082)?

Recombinant Rat Olfactory Receptor 1082 (Olr1082) is a transmembrane protein belonging to the olfactory receptor family, originally identified in Rattus norvegicus. The full-length protein consists of 317 amino acids and functions as an olfactory receptor in the rat olfactory system . As a G protein-coupled receptor (GPCR), it plays a crucial role in olfactory signal transduction by binding to odorant molecules and initiating sensory signaling cascades. The recombinant version is typically produced in expression systems such as E. coli for research purposes . When studying olfactory receptors, researchers must consider their natural membrane-bound state and their functional role in chemosensory perception pathways.

How is recombinant Olr1082 typically produced?

Recombinant Olr1082 is typically produced using E. coli expression systems, with the full-length protein (amino acids 1-317) often fused to affinity tags for purification purposes . The production process involves several key steps: (1) Gene synthesis or cloning of the Olr1082 coding sequence into an appropriate expression vector; (2) Transformation of the expression vector into a compatible E. coli strain; (3) Induction of protein expression under optimized conditions; (4) Cell lysis and protein extraction; (5) Affinity purification using the protein's tag (commonly His-tag); and (6) Quality control analysis, typically via SDS-PAGE to confirm purity (>85-90%) .

The choice of expression system significantly impacts protein yield and quality. While E. coli systems are common due to their cost-effectiveness and high yield, eukaryotic expression systems might be preferable for studies requiring native post-translational modifications. Researchers should consider that transmembrane proteins may require specialized expression and purification protocols to maintain proper folding and functionality.

What are the optimal storage conditions for recombinant Olr1082?

The optimal storage conditions for recombinant Olr1082 depend on the protein formulation (lyophilized or liquid) and intended research timeline. For long-term storage, both lyophilized and liquid forms should be kept at -20°C to -80°C . The shelf life for lyophilized Olr1082 is approximately 12 months at these temperatures, while the liquid form typically remains stable for about 6 months .

For working stocks in active use, aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles . It is critical to avoid repeated freezing and thawing as this can lead to protein denaturation and loss of activity. The buffer composition (typically Tris/PBS-based with stabilizers like trehalose) plays a significant role in maintaining protein stability during storage . Researchers should document storage conditions for each batch to account for potential variations in experimental outcomes due to differences in protein stability over time.

How should Olr1082 be reconstituted for experimental use?

For optimal reconstitution of lyophilized Olr1082, the following methodological approach is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom and prevent loss of material.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being commonly used) to enhance stability.

  • Prepare small working aliquots to minimize freeze-thaw cycles.

  • Store reconstituted aliquots according to the storage guidelines (-20°C/-80°C for long-term; 4°C for up to one week for working stocks) .

The reconstitution buffer composition should be carefully considered based on the specific experimental application. For structural studies or functional assays, specialized buffers that maintain the native conformation of the transmembrane protein might be required. Researchers should validate protein activity after reconstitution using appropriate activity assays specific to olfactory receptors.

What are the primary research applications for recombinant Olr1082?

Recombinant Olr1082 serves as a valuable tool in multiple research applications focusing on olfactory system biology and receptor functionality. Primary applications include:

  • Structural Studies: Investigating the three-dimensional structure of olfactory receptors to understand ligand-binding mechanisms.

  • Ligand Binding Assays: Identifying and characterizing novel odorant molecules that interact with Olr1082.

  • Antibody Production: Generating specific antibodies against Olr1082 for immunohistochemistry and Western blotting.

  • Protein-Protein Interaction Studies: Exploring interactions between Olr1082 and downstream signaling molecules.

  • Comparative Receptor Biology: Analyzing structural and functional differences between various olfactory receptors .

In these applications, researchers must account for the challenges associated with working with transmembrane proteins, including proper folding, orientation, and functional reconstitution. The choice of experimental system should align with the specific research question, considering factors such as the need for post-translational modifications or membrane integration for full functional studies.

How can Olr1082 be used in olfactory signaling pathway studies?

In olfactory signaling pathway studies, recombinant Olr1082 can be utilized through several methodological approaches:

  • Reconstitution into Artificial Membrane Systems: Incorporating purified Olr1082 into liposomes or nanodiscs to study receptor activation in a controlled environment.

  • Cell-Based Assays: Expressing Olr1082 in heterologous cell systems (e.g., HEK293 cells) to monitor receptor activation using calcium imaging, cAMP assays, or BRET/FRET-based methods.

  • Computational Modeling: Using the amino acid sequence (particularly the transmembrane domains) to model ligand-binding sites and predict receptor-ligand interactions.

  • Receptor Mutagenesis: Creating targeted mutations to identify critical residues involved in odorant binding or signal transduction.

When designing these experiments, researchers should consider control conditions, including wild-type vs. mutant receptors and specific vs. non-specific ligand interactions. The hydrophobic nature of the transmembrane regions (evident in the amino acid sequence) necessitates careful experimental design to maintain proper protein folding and functionality . Validation of experimental results using multiple techniques strengthens the reliability of findings in this complex signaling system.

What challenges exist in expressing functional Olr1082 in heterologous systems?

Expressing functional Olr1082 in heterologous systems presents several technical challenges that researchers should address through methodological adaptations:

ChallengeTechnical ImplicationPotential Solution
Protein MisfoldingLoss of functional conformationUse of chaperone co-expression systems
Membrane IntegrationImproper localizationAddition of signal sequences for membrane targeting
Post-translational ModificationsAbsence of critical modificationsSelection of appropriate eukaryotic expression systems
Protein AggregationFormation of inclusion bodiesOptimization of expression conditions (temperature, induction)
Low Expression LevelsInsufficient protein yieldCodon optimization for the expression host
Toxicity to Host CellsGrowth inhibitionUse of inducible expression systems

E. coli expression systems, while commonly used, may not provide the optimal environment for producing fully functional transmembrane proteins like Olr1082 . For studies requiring functional receptors, mammalian or insect cell expression systems might be preferable despite their higher cost and complexity. The experimental question should guide the choice of expression system, balancing considerations of yield, functionality, and experimental requirements.

How can the purity and activity of recombinant Olr1082 be verified?

Verifying both the purity and functional activity of recombinant Olr1082 requires a multi-faceted analytical approach:

Purity Assessment:

  • SDS-PAGE Analysis: The standard method for assessing protein purity, with expected purity levels >85% for typical research applications and >90% for specialized structural studies .

  • Western Blotting: Using specific antibodies to confirm the identity of the purified protein.

  • Size Exclusion Chromatography: Evaluating protein homogeneity and potential aggregation.

  • Mass Spectrometry: Confirming the exact molecular weight and potential modifications.

Functional Activity Assessment:

  • Ligand Binding Assays: Measuring the ability of the receptor to bind known odorant molecules.

  • GTPγS Binding Assays: Evaluating G-protein coupling and activation.

  • Reconstitution into Artificial Membrane Systems: Assessing receptor functionality in a membrane environment.

  • Circular Dichroism: Confirming proper secondary structure formation.

Researchers should establish acceptance criteria for both purity and activity based on their specific experimental requirements. For instance, structural studies might require higher purity standards compared to immunization protocols. Activity assays should include positive controls (known functional olfactory receptors) and negative controls (denatured receptors) to validate the specificity of observed signals.

What strategies can address poor solubility of recombinant Olr1082?

Poor solubility is a common challenge when working with transmembrane proteins like Olr1082. The following methodological strategies can improve solubility:

  • Buffer Optimization:

    • Adjust pH to optimal range for the protein (typically 7.0-8.0 for Olr1082)

    • Test different buffer systems (Tris, phosphate, HEPES)

    • Add stabilizing agents such as trehalose (6%) as used in commercial preparations

  • Detergent Selection:

    • Mild non-ionic detergents (DDM, CHAPS, Triton X-100)

    • Lipid-like detergents for membrane proteins (LMNG, digitonin)

    • Detergent screening to identify optimal conditions

  • Solubilization Aids:

    • Addition of glycerol (5-50%) to prevent aggregation

    • Inclusion of low concentrations of reducing agents

    • Use of specialized solubilization tags (SUMO, MBP, GST)

  • Physical Parameters:

    • Optimize temperature during solubilization (4°C, room temperature)

    • Control protein concentration to prevent self-association

    • Use gentle mixing methods to avoid denaturation

When implementing these strategies, researchers should systematically test conditions using small-scale experiments before proceeding to larger preparations. Documentation of successful conditions is essential for experimental reproducibility across different protein batches or research groups.

How can researchers troubleshoot low yields in Olr1082 expression?

Low yields of recombinant Olr1082 can significantly impede research progress. This methodological troubleshooting guide addresses common causes and solutions:

IssuePotential CausesStrategic Solutions
Poor TranscriptionWeak promoter, DNA template qualityOptimize vector design, use strong promoters
Translation InefficiencyCodon bias, secondary structure in mRNAPerform codon optimization for expression host
Protein ToxicityMembrane disruption by Olr1082Use tightly regulated inducible systems
Inclusion Body FormationRapid expression, improper foldingLower induction temperature (16-20°C), reduce inducer concentration
Proteolytic DegradationHost proteases targeting Olr1082Add protease inhibitors, use protease-deficient strains
Inefficient PurificationTag accessibility, non-specific bindingOptimize tag position (N vs. C-terminal), adjust purification buffers

Expression optimization should begin with small-scale cultures to identify improved conditions before scaling up. The incorporation of solubility-enhancing fusion partners (MBP, SUMO, TRX) has proven effective for many transmembrane proteins and may be beneficial for Olr1082 expression . Systematic documentation of yields under different conditions enables data-driven optimization of production protocols.

How can structural studies of Olr1082 contribute to olfactory receptor research?

Structural studies of Olr1082 provide crucial insights into olfactory receptor function and contribute to the broader understanding of G protein-coupled receptors (GPCRs). Methodological approaches for structural characterization include:

  • X-ray Crystallography: Requiring highly pure, homogeneous, and stable protein preparations, typically necessitating specialized crystallization chaperones or fusion partners for membrane proteins like Olr1082.

  • Cryo-Electron Microscopy: Increasingly used for membrane protein structure determination, allowing visualization of Olr1082 in different conformational states.

  • NMR Spectroscopy: Providing dynamic information about receptor movements during ligand binding and activation.

  • Computational Modeling: Using the amino acid sequence from recombinant preparations to predict structural features and ligand binding sites .

These structural insights allow researchers to: (1) Identify odorant binding pockets within the transmembrane domains; (2) Elucidate conformational changes during receptor activation; (3) Compare structural features across different olfactory receptors; and (4) Guide rational design of receptor mutations for functional studies. The hydrophobic regions evident in the Olr1082 sequence correspond to transmembrane helices that form the core structure of the receptor, with intracellular and extracellular loops mediating signaling and ligand recognition, respectively.

What biotechnological applications exist for engineered variants of Olr1082?

Engineered variants of Olr1082 have potential applications in biotechnology and biosensing. Advanced research in this area includes:

  • Biosensor Development:

    • Integration of modified Olr1082 into electronic devices for odorant detection

    • Development of cell-based sensors using engineered Olr1082 with enhanced sensitivity

    • Creation of portable diagnostic tools for environmental monitoring

  • Altered Ligand Specificity:

    • Rational design of binding pocket mutations to recognize non-natural ligands

    • Directed evolution approaches to generate receptors with novel specificities

    • Computational design of receptors with predicted binding properties

  • Stability Engineering:

    • Introduction of disulfide bonds to enhance thermal stability

    • Surface mutations to improve solubility while maintaining function

    • Fusion with stabilizing protein domains for improved handling

  • Signaling Modifications:

    • Engineering of G-protein coupling specificity to alter downstream signaling

    • Creation of chimeric receptors with modules from other GPCRs

    • Development of constitutively active variants for signaling studies

When pursuing these applications, researchers should establish rigorous validation protocols to confirm that engineered variants maintain the desired functional properties. The design of engineered Olr1082 variants should be guided by the amino acid sequence information and structural predictions derived from the recombinant protein studies .

How does Olr1082 compare to other olfactory receptors in structure and function?

Comparative analysis of Olr1082 within the broader context of olfactory receptors provides valuable insights into evolutionary relationships and functional specialization. The methodological approach to such comparisons involves:

  • Sequence Alignment Analysis:

    • Multiple sequence alignment of Olr1082 with other olfactory receptors

    • Identification of conserved motifs across the olfactory receptor family

    • Analysis of sequence divergence in ligand-binding regions

  • Structural Comparison:

    • Homology modeling based on available GPCR structures

    • Comparison of predicted transmembrane domains and binding pockets

    • Analysis of structural features that determine odorant specificity

  • Functional Comparison:

    • Odorant response profiles across different receptors

    • Signaling efficiency and G-protein coupling preferences

    • Expression patterns in the olfactory epithelium

The full-length sequence of Olr1082 (317 amino acids) contains the characteristic seven transmembrane domain architecture of GPCRs, with specific sequence motifs that distinguish it within the olfactory receptor subfamily . These comparative analyses help researchers understand how structural variations between olfactory receptors translate to functional differences in odorant recognition and signaling properties.

What emerging technologies are advancing Olr1082 research?

Cutting-edge technologies are transforming research capabilities for studying Olr1082 and other olfactory receptors. These methodological advances include:

  • Advanced Expression Systems:

    • Cell-free protein synthesis for rapid production of difficult membrane proteins

    • Nanodiscs and lipid cubic phase systems for native-like membrane environments

    • Specialized chaperone systems for improved folding of transmembrane domains

  • High-Resolution Structural Techniques:

    • Single-particle cryo-EM for membrane protein structures without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Solid-state NMR techniques optimized for membrane proteins

  • Functional Characterization Advances:

    • Single-molecule fluorescence for receptor dynamics studies

    • CRISPR-Cas9 gene editing for in vivo receptor modification

    • Microfluidic systems for high-throughput ligand screening

  • Computational Approaches:

    • Molecular dynamics simulations of receptor-ligand interactions

    • Machine learning algorithms for predicting odorant-receptor pairs

    • Quantum mechanics calculations for binding energy determination

These emerging technologies enable researchers to address previously intractable questions about Olr1082 function and regulation. When implementing these advanced approaches, researchers should carefully validate new methods against established techniques to ensure reliable data interpretation and experimental reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.