Recombinant Rat Olfactory receptor 1174 (Olr1174)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Olr1174 (UniProt ID: P35896) is a 331-amino-acid olfactory receptor belonging to the GPCR superfamily. It is classified under the olfactory receptor subfamily and is alternatively termed Putative Gustatory Receptor PTE33. Recombinant versions are produced in E. coli or mammalian expression systems, often fused with affinity tags for purification and detection .

Expression Systems

Recombinant Olr1174 is produced in multiple platforms, each offering distinct advantages:

Expression SystemHostTagPurityYield
E. coliBL21 strainsHis-tag>90% (SDS-PAGE) 1–5 mg/L
Mammalian Cells (HEK293)Transient transfectionHis-Fc-Avi-tag>80% ~10⁶ receptors/cell
  • Bacterial Systems: Cost-effective for structural studies but may lack native post-translational modifications .

  • Mammalian Systems: Preferred for functional assays due to proper membrane localization .

Functional and Research Applications

  • Ligand Screening: Olr1174 is hypothesized to bind volatile odorants, though specific agonists/antagonists remain uncharacterized .

  • Structural Biology: Used in crystallization trials and cryo-EM studies due to high purity (>90%) .

  • Signal Transduction Assays: Mammalian-expressed Olr1174 is compatible with calcium flux or cAMP detection systems .

Gene and Orthology

PropertyDetails
Gene ID405390 (Rat)
OrthologsMouse: Olfr1174 (ENSMUSG00000080713); Human: OR5D3P (ENSG00000186886)
Chromosomal LocationRat Chr 3:187,543,129–187,548,011 (GRCr8 assembly)

Key Challenges and Future Directions

  • Functional Characterization: Limited data exist on Olr1174’s ligand specificity. High-throughput screening using odorant libraries (as in ) is needed.

  • Structural Insights: Full-length GPCR stabilization remains technically demanding; nanodisc or detergent optimization may improve crystallization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Olr1174; Olfactory receptor 1174; Putative gustatory receptor PTE33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1174
Target Protein Sequence
MKMENHTLISEFFLLDLSDDPKLQPFLFGLFLSMYLVTMLGNLLIILAVSSNSQLHNPMY FFLSNLSFVDICFISTTVPKMLVNMQSQTKDISYIECLTQVYFFNTFVGMDDVLLTLMAY DCFVAICNPLKYTIIMNPRVCTLLVLMFWIIMFCISLIHVLLMNELNFSRGTKIPHFFCE LAQVLKVSNSDTHINNIFMYVLSSLLGVIPMTGILMSYSQIVSSLLRMSSTVSKYKAFST CGSHLCVVCLFYGSVIGVYFSSSVVLSTQRIMVASLMYTVISPMLNPFIYSLRNKDVKVA LGELFIRVAPCPSWINDIITKFILKNIRQNL
Uniprot No.

Target Background

Function
This protein is a potential taste receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Tongue specific.

Q&A

What is Olfactory receptor 1174 (Olr1174) and what is its function in rats?

Olfactory receptor 1174 (Olr1174) is a member of the large G-protein-coupled receptor (GPCR) family that plays a crucial role in olfactory perception. This receptor, also known as putative gustatory receptor PTE33, interacts with odorant molecules in the nasal cavity to initiate neuronal responses that trigger smell perception . The protein consists of 331 amino acids and features the characteristic 7-transmembrane domain structure common to GPCRs .

Functionally, Olr1174 participates in G protein-mediated signal transduction pathways following odorant binding. When activated, it triggers a cascade of intracellular events that ultimately results in action potentials being transmitted to the brain, where they are interpreted as specific odors. The receptor is encoded by a single coding-exon gene and belongs to the largest gene family in the genome .

How is recombinant Olr1174 typically produced for research applications?

Recombinant Olr1174 protein is predominantly produced using bacterial expression systems, with E. coli being the most common host organism . The production process typically involves several key steps:

  • Gene synthesis or cloning of the Olr1174 coding sequence

  • Insertion into an appropriate expression vector containing affinity tags (commonly His-tag)

  • Transformation into competent E. coli cells

  • Induction of protein expression under optimized conditions

  • Cell harvesting and lysis

  • Purification via affinity chromatography targeting the His-tag

  • Quality control testing for purity (typically >85-90% by SDS-PAGE)

  • Final formulation in appropriate buffer and lyophilization

The resulting product is generally provided as a lyophilized powder that can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol and aliquoting for storage at -20°C/-80°C is recommended to prevent protein degradation .

What are the structural characteristics of Olr1174 protein?

Rat Olr1174 has several important structural characteristics:

FeatureDescription
Amino Acid Length331 amino acids (full length)
Structural Motif7-transmembrane domain structure (typical of GPCRs)
Amino Acid SequenceMKMENHTLISEFFLLDLSDDPKLQPFLFGLFLSMYLVTMLGNLLIILAVSSNSQLHNPMYFFLSNLSFVDICFISTTVPKMLVNMQSQTKDISYIECLTQVYFFNTFVGMDDVLLTLMAYDCFVAICNPLKYTIIMNPRVCTLLVLMFWIIMFCISLIHVLLMNELNFSRGTKIPHFFCELAQVLKVSNSDTHINNIFMYVLSSLLGVIPMTGILMSYSQIVSSLLRMSSTVSKYKAFSTCGSHLCVVCLFYGSVIGVYFSSSVVLSTQRIMVASLMYTVISPMLNPFIYSLRNKDVKVALGELFIRVAPCPSWINDIITKFILKNIRQNL
UniProt IDP35896
Gene IDENSRNOG00000049712 (Ensembl), 405390 (Entrez)
Genomic LocationChromosome 8:20609395-20609531

The transmembrane regions of the protein are hydrophobic segments that anchor the receptor in the cell membrane, with the N-terminus positioned extracellularly to interact with odorant molecules and the C-terminus facing the cytoplasm to couple with G proteins for signal transduction.

What are the optimal reconstitution and storage conditions for recombinant Olr1174?

Proper reconstitution and storage of recombinant Olr1174 are critical for maintaining protein functionality in research applications. Based on manufacturer recommendations:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Gently mix to ensure complete dissolution without generating foam

  • For long-term storage, add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot the solution into smaller volumes to avoid repeated freeze-thaw cycles

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C (shelf life approximately 12 months)

  • Store reconstituted protein in glycerol at -20°C/-80°C (shelf life approximately 6 months)

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

The stability of the protein is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself. Using proper pH-buffered solutions (typically Tris/PBS-based buffer, pH 8.0, containing 6% Trehalose) helps maintain structural integrity during storage .

What experimental validation methods are recommended for confirming Olr1174 expression and activity?

Several complementary approaches are recommended for validating both the expression and functional activity of Olr1174 in experimental systems:

Expression Validation:

  • SDS-PAGE analysis: To confirm size and purity (>85-90% purity expected)

  • Western blotting: Using anti-His antibodies (for tagged versions) or specific anti-Olr1174 antibodies

  • QPCR: Using validated primers such as those in the PrimePCR assay (qRnoCED0016560) to detect mRNA expression

  • Immunofluorescence microscopy: To visualize cellular localization and membrane integration

Functional Validation:

  • Calcium flux assays: To measure receptor activation following odorant exposure

  • GTPγS binding assays: To assess G protein coupling

  • cAMP accumulation assays: To confirm downstream signaling pathway activation

  • Electrophysiological recordings: For direct measurement of cellular responses

How can I assess the purity and integrity of recombinant Olr1174 preparations?

Assessing the purity and integrity of recombinant Olr1174 is essential for experimental reproducibility. Several complementary analytical methods should be employed:

Purity Assessment:

  • SDS-PAGE analysis: The primary method for purity determination, with commercial preparations typically exceeding 85-90% purity

  • Size exclusion chromatography (SEC): To detect aggregates and assess homogeneity

  • Western blotting: Using tag-specific antibodies to confirm identity and detect potential degradation products

Integrity Validation:

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content

  • Thermal shift assays: To evaluate protein stability

For SDS-PAGE analysis, a 10-15% polyacrylamide gel is typically used for optimal resolution of the ~37 kDa Olr1174 protein. Staining with Coomassie blue allows visualization of the major band corresponding to the target protein, with densitometric analysis providing quantitative purity assessment. Mass spectrometry can provide additional confirmation of the protein's identity through peptide mapping and sequence coverage analysis.

How can Olr1174 be used in olfactory signaling pathway studies?

Recombinant Olr1174 serves as a valuable tool for investigating olfactory signal transduction mechanisms through several sophisticated experimental approaches:

Reconstitution Systems:

  • Proteoliposome incorporation: Purified Olr1174 can be reconstituted into lipid vesicles to study ligand binding and G protein coupling in a defined membrane environment

  • Cell-free expression systems: For studying receptor biosynthesis and folding dynamics

  • Nanodiscs: For single-molecule studies of receptor conformational changes

Cellular Assays:

  • Heterologous expression: Transfection of Olr1174 into HEK293 or CHO cells allows for controlled studies of receptor trafficking, ligand specificity, and signaling pathway activation

  • CRISPR-engineered neuronal cell lines: For investigating receptor function in a more physiologically relevant context

  • Calcium imaging: To visualize real-time signaling events following receptor activation

Structural Biology Applications:

  • Cryo-electron microscopy: For structural determination of the receptor in different conformational states

  • Hydrogen-deuterium exchange mass spectrometry: To map ligand-binding sites and conformational changes

  • Molecular dynamics simulations: Using the protein sequence to model receptor-ligand interactions

These approaches collectively provide insights into how Olr1174 contributes to the remarkable sensitivity and specificity of the olfactory system in discriminating thousands of different odorants.

What is known about differential expression patterns of Olr1174 in neurological injury models?

Research utilizing microarray analysis has revealed significant expression changes of Olr1174 in neurological injury models, particularly in sciatic nerve (SN) resection studies:

Microarray analysis of rat L4-6 dorsal root ganglia (DRG) and proximal sciatic nerve (SN) tissues following sciatic nerve resection showed differential expression patterns of various genes, including olfactory receptors . The expression of Olr1174 was analyzed at multiple time points (day 0, 1, 4, 7, and 14) post-injury.

Significant differential expression patterns were observed, with fold changes >1.5 and t-test p-values <0.05 (adjusted using the false discovery rate method) . This suggests that Olr1174 may play roles beyond canonical olfactory functions, potentially participating in neuronal regeneration or injury response pathways.

The expression patterns differed between DRG and SN tissues, indicating tissue-specific regulatory mechanisms. Interestingly, these changes occurred in conjunction with alterations in non-coding RNA expression patterns, suggesting potential regulatory relationships between ncRNAs and Olr1174 expression . These findings point to previously unrecognized roles for olfactory receptors in neurological injury response and repair mechanisms.

What bioinformatic approaches are recommended for analyzing Olr1174 in gene expression datasets?

Advanced bioinformatic strategies can enhance the analysis of Olr1174 in complex gene expression datasets:

Data Processing Workflow:

  • Microarray data normalization: Using robust multi-array average (RMA) or quantile normalization methods

  • Differential expression analysis: Employing tools like GeneSpring with fold change thresholds (>1.5) and statistical significance criteria (p<0.05, FDR-adjusted)

  • Probe-to-gene mapping: Addressing multi-mapping issues using FDR cutoffs (q<0.05)

  • Cross-platform validation: Comparing results across different microarray platforms or with RNA-seq data

Contextual Analysis Approaches:

  • Genomic neighborhood analysis: Examining expression correlations with genes within defined genomic distances from the Olr1174 locus

  • Network inference: Building connectivity networks among co-expressed genes to identify functional modules

  • Pathway enrichment analysis: Using tools like GeneGo MetacoreTM to identify biological pathways associated with Olr1174 expression changes

Integration with Non-coding RNA Data:

  • Correlation analysis: Identifying potential regulatory relationships between Olr1174 and non-coding RNAs (lincRNAs, antisense RNAs, pseudogenes)

  • Expression pattern clustering: Grouping genes with similar expression profiles across experimental conditions

  • Regulatory network reconstruction: Inferring potential regulatory interactions

These approaches can reveal unexpected functional associations and regulatory mechanisms involving Olr1174, particularly in neuronal tissues where its non-canonical functions may be important .

What are common challenges in expressing functional Olr1174 and how can they be addressed?

Expressing functional membrane proteins like Olr1174 presents several challenges that can be addressed through optimized protocols:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for E. coli expression, use strong inducible promoters (e.g., T7), and test different E. coli strains (BL21(DE3), Rosetta, C41/C43)

  • Strategy: Start with low induction temperatures (16-18°C) and extended expression times (overnight) to enhance proper folding

  • Alternative: Consider using cell-free expression systems which can sometimes yield better results for membrane proteins

Challenge 2: Protein Aggregation/Inclusion Bodies

  • Solution: Include solubilizing agents such as mild detergents (DDM, CHAPS) in the lysis buffer

  • Strategy: Employ fusion partners that enhance solubility (e.g., MBP, SUMO, Trx)

  • Refolding Protocol: If inclusion bodies form, develop a refolding protocol using step-wise dialysis from denaturing conditions

Challenge 3: Maintaining Functional Conformation

  • Solution: Use lipid/detergent mixtures that mimic native membrane environments

  • Strategy: Add stabilizing agents such as cholesterol or specific phospholipids during purification

  • Validation: Implement functional assays at each purification step to track activity retention

Challenge 4: Poor Stability After Reconstitution

  • Solution: Optimize buffer conditions (pH, salt concentration) and add stabilizers like glycerol (5-50%)

  • Storage: Aliquot and store at -80°C immediately after purification to minimize degradation

  • Handling: Avoid repeated freeze-thaw cycles, limiting to working aliquots at 4°C for up to one week

These strategies collectively enhance the likelihood of obtaining functionally active Olr1174 for downstream experimental applications.

How can experimental artifacts be distinguished from true results when studying Olr1174?

Distinguishing experimental artifacts from genuine findings requires rigorous experimental design and appropriate controls:

Protein-Level Validation:

  • Tag interference controls: Compare tagged vs. untagged versions to ensure tag presence doesn't alter function

  • Expression level normalization: Standardize protein quantities across experimental conditions using quantitative Western blotting

  • Functional control proteins: Include closely related olfactory receptors to assess specificity of observed effects

  • Negative controls: Use mock-transfected/transformed systems containing empty vectors

RNA-Level Validation:

  • Primer specificity verification: Confirm PCR primer specificity through sequencing of amplicons, particularly important given the high sequence similarity among olfactory receptor family members

  • Multiple reference genes: Use at least three validated reference genes for RT-qPCR normalization

  • Genomic DNA contamination controls: Include no-RT controls to detect genomic DNA interference (especially important as Olr1174 arises from a single-exon gene)

Signal Transduction Validation:

  • Specific antagonists: Use receptor-specific and pathway-specific inhibitors to confirm signal specificity

  • Dose-response curves: Generate complete dose-response relationships to confirm biological relevance

  • Alternative detection methods: Confirm findings using independent methodological approaches

The known high efficiency (99%) and specificity (no cross-reactivity) of validated qPCR assays for Olr1174 provide a solid foundation for reliable expression analysis , but rigorous validation remains essential for all experimental systems.

What is the emerging role of Olr1174 in non-olfactory tissues?

Recent research has uncovered unexpected roles for olfactory receptors, including Olr1174, beyond their canonical sensory functions:

Neuronal Injury and Regeneration:
Analysis of gene expression patterns following sciatic nerve resection has revealed significant differential expression of Olr1174 in both dorsal root ganglia (DRG) and sciatic nerve (SN) tissues . This temporal regulation pattern suggests potential involvement in neuronal injury response and regeneration processes. The differential expression occurs in specific time windows post-injury (days 1, 4, 7, and 14), indicating precise temporal regulation .

Potential Regulatory Networks:
Contextual analysis of genomic data has identified significant co-expression patterns between Olr1174 and various non-coding RNAs, including long intergenic non-coding RNAs (lincRNAs), antisense RNAs, and pseudogenes . These relationships suggest complex regulatory networks potentially involving Olr1174 in processes beyond olfaction.

Pathway Integration:
GeneGo pathway analysis has revealed associations between differentially expressed olfactory receptors and neurodegeneration/neurogenesis processes , suggesting that Olr1174 may participate in cellular signaling networks relevant to neuronal health and function.

These findings collectively point to a paradigm shift in understanding olfactory receptor biology, suggesting that proteins like Olr1174 may serve as versatile signaling molecules in multiple tissue contexts beyond their classical role in odor detection.

How is Olr1174 being utilized in comparative receptor studies?

Recombinant Olr1174 serves as a valuable model for comparative studies of G-protein coupled receptors across species and functional classes:

Evolutionary Analysis:
As part of the largest gene family in the genome, olfactory receptors including Olr1174 provide excellent models for studying evolutionary mechanisms including gene duplication, diversification, and selection pressures . Comparative sequence analysis across species reveals conserved functional domains and species-specific adaptations.

Structure-Function Relationships:
The 7-transmembrane domain architecture of Olr1174 shares structural similarities with other GPCRs including neurotransmitter and hormone receptors . This makes it valuable for comparative studies of ligand binding mechanisms, signal transduction pathways, and conformational dynamics across GPCR classes.

Methodological Development:
Expression and purification protocols optimized for Olr1174 can inform approaches for other challenging membrane proteins. The validated assays, including the high-efficiency qPCR method (99% efficiency, R²=0.9999) , provide templates for developing similar tools for related receptors.

Cross-Species Comparisons:
The rat Olr1174 protein serves as a model for understanding human olfactory receptor biology, with insights potentially transferable across species barriers despite the independent nomenclature systems used for olfactory receptors in different organisms .

These comparative approaches enhance our understanding of not only Olr1174's specific functions but also broader principles of GPCR biology that apply across this important receptor superfamily.

What are promising approaches for identifying physiological ligands of Olr1174?

Identifying the natural ligands of orphan receptors like Olr1174 remains a significant challenge that can be addressed through multiple complementary strategies:

High-Throughput Screening Approaches:

  • Combinatorial odor libraries: Systematic screening of odor compound collections using calcium imaging or reporter gene assays in cells expressing Olr1174

  • Fragment-based screening: Testing smaller molecular fragments that can be assembled into potential ligands

  • Virtual screening: Computational docking of compound libraries based on Olr1174 structural models derived from its amino acid sequence

Physiological Approaches:

  • Reverse transcriptase-PCR mapping: Detailed characterization of Olr1174 expression patterns across tissues to identify potential non-olfactory sites where natural ligands might be present

  • Ex vivo tissue preparations: Testing tissue extracts for Olr1174 activation to identify endogenous ligands

  • In vivo calcium imaging: Visualization of neuronal activation patterns in response to defined odor sets

Chemoinformatic Strategies:

  • Structure-activity relationship (SAR) analysis: Systematic modification of molecular scaffolds to identify key pharmacophore features

  • Bioisostere replacement: Testing chemically similar compounds to known partial activators

  • Machine learning approaches: Training algorithms on known olfactory receptor-ligand pairs to predict potential Olr1174 ligands

These methodologies collectively provide a comprehensive framework for deorphanizing Olr1174 and understanding its ligand selectivity profile, with implications for both basic olfactory biology and potential therapeutic applications.

How might Olr1174 research contribute to understanding neurodegenerative diseases?

Emerging evidence suggests potential connections between olfactory receptors and neurodegenerative processes that merit further investigation:

Olfactory Dysfunction and Neurodegeneration:
Olfactory impairment often precedes clinical symptoms in neurodegenerative diseases like Parkinson's and Alzheimer's. Understanding the molecular mechanisms involving olfactory receptors like Olr1174 could provide early biomarkers or therapeutic targets .

Pathway Analysis Connections:
GeneGo pathway analysis has identified significant associations between differentially expressed genes (including olfactory receptors) and neurodegeneration/neurogenesis processes following nerve injury . This suggests that Olr1174 may participate in cellular networks relevant to neuronal health and degeneration.

Non-canonical Signaling Pathways:
If Olr1174 functions in non-olfactory tissues as suggested by expression data , it may participate in signaling pathways relevant to neuronal survival, axonal guidance, or synaptic maintenance. These functions could be disrupted in neurodegenerative conditions.

Biomarker Potential:
Changes in Olr1174 expression patterns following neuronal injury suggest its potential as a biomarker for monitoring disease progression or therapeutic response. Similar olfactory receptors (OLR1) have already been identified as potential biomarkers in other contexts like non-small cell lung cancer .

Future research should explore these connections through detailed expression profiling in neurodegenerative disease models, functional studies of Olr1174 in neuronal contexts, and potential therapeutic interventions targeting Olr1174-mediated signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.