Recombinant Rat Olfactory receptor 1496 (Olr1496)

Shipped with Ice Packs
In Stock

Description

Table 1: Sequence Information

FeatureDetail
Uniprot IDP23269
Gene NameOlr1496
AA SequenceMNNQTFITQFLLLGLPIPEEHQHL...
Expression RegionFull length (1-310)

Production Methods

Commercial variants are produced using multiple expression systems:

Table 2: Recombinant Production Platforms

Host SystemTagPuritySupplier
E. coliHis≥85%Creative BioMart
Cell-Free ExpressionNone≥85%MyBioSource
Mammalian CellsCustom≥85%ABM

Purification typically involves affinity chromatography followed by SDS-PAGE validation . Storage requires Tris-based buffers with 50% glycerol at -20°C/-80°C .

Ligand Interactions

  • Olr1496 participates in odorant discrimination through residues in transmembrane domains (TM3, TM5, TM6)

  • Key binding pocket residues (e.g., positions 2.54, 3.36) govern ligand specificity and basal activity

Signaling Mechanisms

  • Exhibits constitutive (ligand-independent) activity modulated by conserved motifs near the odorant-binding pocket

  • Requires RTP family chaperones for ER-to-cell-surface trafficking

Table 3: Functional Residues

Functional RoleResidue PositionsImpact
Ligand SpecificityTM2, TM3, TM5, TM7Odorant selectivity
Basal ActivityNear conserved motifsIntrinsic activation

Knockdown Systems

  • siRNA Lentivectors: Four constructs targeting NM_001000716.1 with guaranteed ≥70% knockdown efficiency

  • Validation: Requires qPCR analysis post-transfection (≥5 nM concentration, 48-hr assay)

Assay Platforms

  • ELISA Kits: Detect Olr1496 in biological samples using optimized buffers

  • Yeast Two-Hybrid: Identified direct protein interactors

Biological Implications

  • Neuronal Development: Basal activity influences axon targeting to olfactory bulb glomeruli

  • Ectopic Expression: Potential biomarker for non-olfactory tissues

  • Evolutionary Conservation: Rat ortholog shares functional motifs with human/mouse ORs

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

  • Functional Assays: Use HEK293 cells co-transfected with RTP1/2 for proper surface expression

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for arrangement, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olr1496; Olfactory receptor 1496; Olfactory receptor-like protein I3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1496
Target Protein Sequence
MNNQTFITQFLLLGLPIPEEHQHLFYALFLVMYLTTILGNLLIIVLVQLDSQLHTPMYLF LSNLSFSDLCFSSVTMPKLLQNMRSQDTSIPYGGCLAQTYFFMVFGDMESFLLVAMAYDR YVAICFPLHYTSIMSPKLCTCLVLLLWMLTTSHAMMHTLLAARLSFCENNVVLNFFCDLF VLLKLACSDTYINELMIFIMSTLLIIIPFFLIVMSYARIISSILKVPSTQGICKVFSTCG SHLSVVSLFYGTIIGLYLCPAGNNSTVKEMVMAMMYTVVTPMLNPFIYSLRNRDMKRALI RVICSMKITL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

UniGene: Rn.113469

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Olfactory epithelium.

Q&A

What is Olfactory Receptor 1496 (Olr1496) and what are its key characteristics?

Olfactory receptor 1496 (Olr1496) is a G protein-coupled receptor expressed in rat olfactory sensory neurons. It belongs to the large family of olfactory receptors responsible for detecting odorants and initiating the sense of smell. This receptor is also known as "Olfactory receptor-like protein I3" in some contexts .

Olr1496, like other olfactory receptors, likely functions by binding specific odorant molecules, which triggers a signaling cascade leading to action potential generation in olfactory sensory neurons. While the specific ligands for Olr1496 have not been extensively characterized in the available research, the receptor shares structural and functional properties with other members of the olfactory receptor family.

What forms of recombinant Olr1496 are available for research purposes?

Based on the available information, Recombinant Rat Olfactory receptor 1496 (Olr1496) is commercially available in several forms:

Product FormExpression SystemPurityAdditional Notes
Full-length Olr1496E. Coli/Yeast/Baculovirus/Mammalian Cell≥85% (SDS-PAGE)Complete receptor sequence
Full-length Olr1496Cell-Free Expression≥85% (SDS-PAGE)Alternative expression system
Partial Olr1496E. Coli/Yeast/Baculovirus/Mammalian Cell≥85% (SDS-PAGE)Truncated sequence

Each form offers specific advantages depending on the research application. The cell-free expression system may provide benefits for functional studies as it can potentially better preserve the native conformation of membrane proteins like olfactory receptors .

How can I confirm the purity and activity of recombinant Olr1496?

The purity of recombinant Olr1496 can be assessed using standard protein analysis techniques:

  • SDS-PAGE analysis: Commercial preparations typically guarantee ≥85% purity as determined by SDS-PAGE . Researchers should run their own verification gels upon receiving the protein.

  • Western blot analysis: Using antibodies specific to Olr1496 or to tags incorporated in the recombinant construct.

  • Functional activity assays: Similar to those used for other olfactory receptors, implementing:

    • Luciferase reporter assays that measure cAMP elevation (as ORs are GPCRs that couple to stimulatory G proteins)

    • Calcium imaging assays to detect receptor activation

    • Surface expression confirmation using techniques like immunocytochemistry with non-permeabilized cells

When assessing activity, it's important to note that olfactory receptors often have limited functionality outside their native membrane environment, so expression systems and assay conditions must be optimized.

What are the most effective heterologous expression systems for functional studies of Olr1496?

Selection of an appropriate expression system is crucial for functional studies of olfactory receptors including Olr1496. Based on research with other ORs, the following considerations apply:

Expression SystemAdvantagesLimitationsOptimization Strategies
Mammalian Cells (HEK293T)Native-like post-translational modifications; Endogenous G-protein couplingVariable surface expressionUse Rho-tag/M3-tag fusion; Co-express with RTP1S/RTP2 chaperones
Baculovirus/Sf9High protein yield; Good for structural studiesMay lack mammalian PTMsOptimize codon usage; Use insect cell-specific promoters
Cell-Free SystemsAvoids cellular trafficking issues; Rapid productionLimited post-translational modificationsSupplement with lipid nanodiscs or microsomes
YeastCost-effective; Eukaryotic processingDifferent membrane compositionUse strains with humanized sterol composition

For functional characterization of Olr1496, mammalian expression systems with OR trafficking enhancers represent the current gold standard approach. Similar to techniques used for other ORs, researchers can employ the Rho-tag (first 20 amino acids of rhodopsin) to enhance surface expression . Additionally, co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) has proven effective for many ORs and would likely benefit Olr1496 studies.

What techniques can be used to identify potential ligands for Olr1496?

Identifying ligands for orphan olfactory receptors like Olr1496 requires systematic approaches:

  • High-throughput screening methods:

    • Luciferase-based cAMP reporter assays in heterologous expression systems

    • Calcium imaging with fluorescent indicators in transfected cells

    • Membrane potential dyes to detect depolarization upon receptor activation

  • In vivo approaches:

    • Phosphorylated ribosome immunoprecipitation (pS6-IP) followed by RNA-Seq to identify activated ORs in odor-stimulated animals

    • This technique has successfully identified OR-odorant pairs by exposing mice to odorants and analyzing which OR mRNAs associate with phosphorylated ribosomes in activated neurons

  • Computational prediction methods:

    • Structural modeling of the receptor binding pocket based on homology to characterized ORs

    • Machine learning approaches using electronic nose (eNose) data to predict receptor-ligand interactions

    • Support vector machine (SVM) and logistic regression models with variable selection using elastic net penalty have been successfully applied to predict OR responses to odorants

A multi-faceted approach combining these methods would be most effective for deorphanizing Olr1496.

How can I determine the expression profile of Olr1496 across different tissues?

To determine the expression profile of Olr1496 across tissues:

  • RT-PCR screening:

    • Design gene-specific primers that amplify unique sequences of Olr1496

    • Extract total RNA from various tissues (kidney, heart, skeletal muscle, lung, liver, stomach, reproductive organs)

    • Perform RT-PCR and sequence any resulting bands to confirm specificity

    • Include appropriate housekeeping genes as controls

  • RNA-Seq analysis:

    • Perform transcriptome analysis on tissues of interest

    • Apply appropriate normalization and statistical analysis to identify differential expression

    • Validate findings with qRT-PCR

  • In situ hybridization:

    • Use RNA probes specific to Olr1496 to visualize expression in tissue sections

    • Combine with immunohistochemistry for cell-type specific markers to identify the exact cell populations expressing the receptor

This comprehensive approach has revealed that many olfactory receptors initially thought to be exclusively expressed in olfactory epithelium are actually expressed in multiple tissues, potentially serving non-olfactory functions .

What experimental approaches can determine the signaling pathways activated by Olr1496?

Understanding the signaling pathways activated by Olr1496 requires:

  • G-protein coupling analysis:

    • BRET/FRET assays to directly measure receptor-G protein interactions

    • Specific G-protein inhibitors (PTX for Gαi/o, YM-254890 for Gαq/11) to determine pathway dependency

    • Measurement of second messengers (cAMP, Ca²⁺, IP₃) following receptor activation

  • Downstream effector identification:

    • Phosphorylation assays for MAPK/ERK pathways

    • Transcriptional reporter assays for various response elements (CRE, SRE, NFAT-RE)

    • Proteomic approaches (phosphoproteomics, proximity labeling) to identify interaction partners

  • Functional readouts in native or model systems:

    • Electrophysiological recordings (patch-clamp) to measure channel activities

    • Live-cell imaging with pathway-specific fluorescent biosensors

    • Knockout/knockdown experiments to validate pathway components

A comparative analysis with other characterized olfactory receptors can provide insights into whether Olr1496 follows canonical or non-canonical signaling mechanisms.

How can I develop a transgenic system to study Olr1496 function in vivo?

Developing transgenic systems for Olr1496 study:

  • Gene targeting approaches:

    • CRISPR/Cas9-mediated genome editing to:

      • Create knockout models to study loss-of-function effects

      • Insert reporter genes (GFP, mCherry) to visualize expressing cells

      • Generate models with point mutations to study structure-function relationships

  • Olfactory neuron-specific transgenic strategies:

    • Use the Tet-Off/Tet-On system for temporal control of expression

    • Employ the UAS-GAL4 system for spatial control

    • Consider using the olfactory marker protein (OMP) promoter for olfactory-specific expression

  • Viral vector approaches:

    • AAV vectors for targeted delivery to the olfactory epithelium

    • Lentiviral vectors for stable integration and expression

  • Validation and analysis techniques:

    • Immunohistochemistry to confirm expression pattern

    • Functional imaging of olfactory bulb glomeruli using calcium indicators

    • Behavioral assays to assess olfactory perception

This approach has been successfully used to study other olfactory receptors, as demonstrated in research where genetically labeled receptor-positive axons were used to provide evidence of receptor activation in the olfactory bulb .

What are the best practices for optimizing the functional expression of Olr1496 in heterologous systems?

To optimize functional expression of Olr1496:

  • Codon optimization:

    • Adapt the coding sequence to the codon usage bias of the expression host

    • Remove rare codons that might cause ribosomal stalling

  • N-terminal modifications:

    • Add trafficking enhancement tags (e.g., first 20 amino acids of rhodopsin)

    • Consider using the Lucy-Flag tag system that has enhanced surface expression for many ORs

  • Co-expression with accessory proteins:

    • Receptor Transporting Proteins (RTPs), particularly RTP1S

    • Receptor Expression Enhancing Proteins (REEPs)

    • Olfactory G protein (Gαolf)

  • Culture condition optimization:

    • Lower incubation temperature (33°C instead of 37°C)

    • Chemical chaperones (e.g., DMSO, glycerol, 4-phenylbutyric acid)

    • Modulate culture media composition

  • Expression verification:

    • Establish a robust surface expression assay using non-permeabilized immunocytochemistry

    • Employ flow cytometry to quantify surface expression levels

    • Use Western blotting to confirm total protein expression

These strategies have significantly improved the functional expression of numerous olfactory receptors in heterologous systems and would likely benefit Olr1496 studies as well.

How can I analyze the structural characteristics of Olr1496 and predict its binding properties?

For structural analysis and binding prediction:

  • Homology modeling:

    • Generate 3D models based on crystal structures of GPCRs

    • Refine models using molecular dynamics simulations

    • Validate models through mutagenesis of predicted key residues

  • Binding pocket analysis:

    • Identify conserved motifs and variable regions

    • Perform molecular docking simulations with potential ligands

    • Use molecular dynamics to simulate receptor-ligand interactions over time

  • Machine learning approaches:

    • Apply support vector machine (SVM) algorithms to predict potential ligands

    • Implement logistic regression with variable selection using elastic net penalty

    • Validate predictions using in vitro functional assays

  • Sequence-based comparative analysis:

    • Align Olr1496 with functionally characterized ORs to identify shared amino acid residues that might confer similar ligand specificities

    • Construct phylogenetic trees to place Olr1496 in context with ORs of known function

This integrated approach has been successful in identifying amino acid residues that facilitate odor binding for other ORs and could be applied to Olr1496 .

What experimental controls are essential when performing ligand screening assays for Olr1496?

Essential controls for ligand screening assays include:

  • Positive controls:

    • Well-characterized OR-ligand pairs (e.g., Olfr160/M72 with acetophenone)

    • Constitutively active GPCR to confirm assay functionality

  • Negative controls:

    • Empty vector transfections

    • Unrelated ORs not expected to respond to test odorants

    • Vehicle controls for all solvents used for odorant preparation

  • Technical controls:

    • Normalization controls (e.g., constitutively active Renilla luciferase in dual-luciferase reporter assays)

    • Cell viability assays to ensure observations are not due to toxicity

    • Surface expression verification to confirm receptor trafficking

  • Validation approaches:

    • Concentration-response curves to determine EC50 values

    • Multiple assay formats (cAMP, calcium, membrane potential) for cross-validation

    • Dose-dependent responses to establish specificity

  • Data analysis considerations:

    • Appropriate statistical methods for high-throughput screening data

    • Correction for multiple comparisons when testing numerous compounds

    • Robust normalization to account for plate-to-plate variations

These controls ensure the reliability and reproducibility of ligand screening results for Olr1496, following best practices established in OR research .

How can Olr1496 research contribute to understanding non-olfactory functions of olfactory receptors?

Olfactory receptors are increasingly recognized for their non-olfactory functions:

  • Tissue expression profiling:

    • RT-PCR screening across diverse tissues (similar to approaches used for other ORs)

    • RNA-Seq analysis to quantify expression levels

    • Single-cell transcriptomics to identify specific cell types expressing Olr1496

  • Functional characterization in non-olfactory tissues:

    • Knockdown/knockout studies to assess physiological roles

    • Calcium imaging and electrophysiology to characterize signaling

    • Metabolic assays if expressed in tissues like liver or kidney

  • Potential roles to investigate:

    • Chemosensation in the gut

    • Metabolic regulation

    • Cell migration and development

    • Vascular regulation

    • Renal function (as other ORs have been found in the kidney)

Understanding Olr1496's potential non-olfactory functions could provide insights into novel physiological mechanisms and potential therapeutic targets.

What are the implications of Olr1496 research for understanding concentration-dependent odor coding?

Research on olfactory receptors has revealed important principles about concentration-dependent odor coding:

  • Receptor recruitment mechanisms:

    • At low concentrations, odorants activate high-affinity receptors

    • Increasing concentrations recruit additional receptors with lower affinity

    • Determining where Olr1496 fits in this recruitment pattern would contribute to understanding its role in odor perception

  • Concentration-invariant odor identity:

    • The olfactory system maintains perception of odor identity across concentrations

    • This requires understanding how the combinatorial activity of receptor populations, potentially including Olr1496, is processed

  • Experimental approaches:

    • pS6-IP followed by RNA-Seq to identify activated OR repertoires across concentration ranges

    • In vivo imaging of olfactory bulb activity patterns

    • Behavioral assays testing discrimination at different concentrations

These investigations would place Olr1496 within the broader context of concentration-dependent olfactory coding mechanisms that facilitate both concentration discrimination and concentration-invariant odor recognition .

How can computational approaches enhance Olr1496 functional characterization?

Computational methods offer powerful tools for OR research:

  • Machine learning for ligand prediction:

    • Support vector machine (SVM) with radial basis kernel to identify potential Olr1496 ligands

    • Logistic regression with variable selection using elastic net penalty

    • Validation of predictions using in vitro functional assays

  • Molecular dynamics simulations:

    • Simulate receptor conformational changes upon ligand binding

    • Identify key amino acid residues involved in ligand interactions

    • Predict effects of mutations on receptor function

  • Systems biology approaches:

    • Network analysis to understand Olr1496's place in the olfactory coding system

    • Integration of transcriptomic, proteomic, and functional data

    • Modeling of signal transduction pathways

  • Electronic nose (eNose) technology:

    • Use eNose fingerprints to predict biological interactions

    • Correlation of physical and chemical properties with receptor activation

    • Development of predictive models for receptor-ligand interactions

These computational approaches have successfully predicted OR-ligand interactions for other receptors and could be valuable for characterizing Olr1496 .

How might single-cell technologies advance our understanding of Olr1496 function?

Single-cell technologies offer powerful approaches for studying olfactory receptors:

  • Single-cell RNA sequencing:

    • Characterize the transcriptome of individual Olr1496-expressing cells

    • Identify co-expressed genes that may modulate receptor function

    • Map developmental trajectories of receptor-expressing neurons

  • Single-cell proteomics:

    • Profile the proteome of Olr1496-expressing cells

    • Identify post-translational modifications affecting receptor function

    • Characterize protein-protein interaction networks

  • Functional genomics at single-cell resolution:

    • CRISPR-based screens to identify genes affecting Olr1496 expression/function

    • Patch-seq combining electrophysiology with transcriptomics

    • Calcium imaging combined with single-cell RNA-seq to correlate functional responses with gene expression

  • Spatial transcriptomics:

    • Map the precise localization of Olr1496-expressing cells in tissues

    • Investigate spatial relationships with other cell types

    • Correlate expression patterns with functional zones

These approaches would provide unprecedented insights into the cellular context of Olr1496 function and regulation, similar to advances made with other ORs .

What are the considerations for developing Olr1496 as a biosensor for specific chemical detection?

Developing Olr1496-based biosensors would require:

  • Receptor characterization:

    • Comprehensive ligand screening to identify specific activators

    • Determination of detection limits and dynamic range

    • Assessment of selectivity against structural analogs

  • Biosensor design strategies:

    • Cell-based systems using reporter genes (luciferase, fluorescent proteins)

    • Cell-free systems incorporating purified receptor in nanodiscs or liposomes

    • Solid-state sensors with immobilized receptor or receptor-derived peptides

  • Signal transduction and detection methods:

    • Electrical (impedance-based, field-effect transistors)

    • Optical (fluorescence, surface plasmon resonance)

    • Mechanical (cantilever-based, quartz crystal microbalance)

  • Performance optimization:

    • Stability enhancement through protein engineering

    • Sensitivity improvement via signal amplification

    • Miniaturization and multiplexing capabilities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.