Recombinant Rat Olfactory receptor 1571 (Olr1571)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While the specific odorants activating Olr1571 remain uncharacterized, functional parallels can be drawn from related olfactory receptors:

  • Broad Tuning: Like other rat olfactory receptors, Olr1571 likely exhibits broad responsiveness to structurally diverse odorants, as observed in extracellular recordings of rat olfactory neurons .

  • Ligand Specificity: Odorant receptors (ORs) typically bind multiple ligands via combinatorial coding. For example, the mouse M71 OR responds to acetophenone and benzaldehyde, while rat I7 detects octanal . Similar ligand promiscuity is expected for Olr1571.

  • Signal Transduction: Binding to odorants triggers G protein-mediated cAMP signaling, opening ion channels to generate action potentials .

Research Applications

Recombinant Olr1571 is primarily used in:

  • Ligand Screening: Identification of odorants or pheromones via calcium imaging or electrophysiology .

  • Antibody Production: Immunogen for generating anti-OR antibodies .

  • Structural Studies: Analysis of membrane protein folding and receptor-ligand interactions .

Experimental Data

ApplicationMethodologyOutcome
ExpressionE. coli with N-terminal His tag High-yield soluble protein production
PurificationImmobilized metal affinity chromatography >90% purity confirmed by SDS-PAGE
StabilityLyophilized in Tris/PBS buffer + 6% trehalose Stable at -80°C for long-term storage

Comparative Analysis with Related Receptors

ReceptorSpeciesLigands IdentifiedExpression SystemKey Findings
M71MouseAcetophenone, BenzaldehydeGene-targeted mice Axonal convergence to distinct glomeruli
I7RatOctanalBaculovirus/Sf9 cells Ligand specificity altered by single amino acid changes
Olr1571RatUndeterminedE. coli Structural homology to M71/I7 subfamily

Future Research Directions

  1. Ligand Identification: High-throughput screening to map odorant-binding profiles.

  2. Tissue-Specific Roles: Investigate its putative gustatory or testicular functions .

  3. Structural Resolution: Cryo-EM studies to elucidate ligand-binding pockets and activation mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olr1571; Olfactory receptor 1571; Putative gustatory receptor PTE58; Testis-expressed odorant receptor mT15r; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1571
Target Protein Sequence
LLMCNLCFADICFTSASIPTNLVNIQTKNKVITYEGCISQVYFFILFGVLDNFLLAVMAY DRYVAICHPLHYTVIMNRRLCGLLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCE LNQLVLLACNDTFPNDMVMYFAAVLLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFST CASHLSVVSLFYSTLLGVYLSSSFTQNSHSTARASVMYSVVTPMLNPFIYSLRNKDLMGA LRRLFRRKP
Uniprot No.

Target Background

Function
Possible taste receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Tongue specific.

Q&A

What is Rat Olfactory receptor 1571 (Olr1571) and where is it expressed?

Olr1571 is a G protein-coupled receptor originally identified in rat olfactory epithelium as part of the olfactory sensing system. It is also known as Putative gustatory receptor PTE58 and Testis-expressed odorant receptor mT15r . While initially characterized in chemosensory tissues, Olr1571 shows significant ectopic expression in multiple non-chemosensory tissues.

Notable expression has been documented in:

  • Heart tissue (specifically identified as Olr1654 in rat heart)

  • Testicular tissue (as ortholog of human OR7A5)

  • Various other peripheral tissues where olfactory receptors have been detected outside their canonical locations

The expression of Olr1571 in non-chemosensory tissues suggests broader physiological roles beyond olfaction, potentially in tissue-specific signaling pathways that remain to be fully characterized .

How does Olr1571 relate to human olfactory receptors?

Olr1571 is considered the rat ortholog of human OR7A5 . This orthology provides opportunities for comparative studies between species and potential translational research. The evolutionary conservation of these receptors across mammals suggests functional importance beyond species-specific olfactory perception.

Human ReceptorRat OrthologMouse OrthologAnalysis Method
OR7A5 (HTPCR2)Olr1571, ratchr11-86418029-86418739_ORFOlfr19, M12, MOR140-1, MTPCR15RT-PCR, Q-PCR, CI, MA

Understanding these cross-species relationships helps researchers develop appropriate model systems and interpret findings in the context of evolutionary conservation and divergence of olfactory receptor functions.

What techniques are most effective for detecting Olr1571 expression?

Multiple complementary techniques are recommended for comprehensive characterization of Olr1571 expression:

  • Transcriptional analysis:

    • RT-PCR and quantitative PCR remain the gold standards for detecting Olr1571 mRNA expression

    • In situ hybridization (ISH) can localize expression to specific cell types within tissues

    • RNA-seq and microarray approaches provide broader transcriptomic context

  • Protein detection:

    • ELISA assays using specific antibodies can quantify Olr1571 protein in tissue homogenates, cell lysates, and biological fluids

    • Western blotting for semi-quantitative protein detection

    • Immunohistochemistry (IHC) for spatial localization within tissues

  • Functional detection:

    • Calcium imaging to detect receptor activation

    • cAMP assays (such as luciferase-based cAMP reporter assays) to measure downstream signaling

The integration of these approaches provides validation through multiple methodologies, which is particularly important given the challenges of specifically detecting olfactory receptors outside their primary tissues .

What are the key considerations for using Olr1571 ELISA kits?

When using ELISA kits for Olr1571 detection and quantification, researchers should consider the following methodological factors:

  • Sample preparation:

    • ELISA kits are validated for tissue homogenates, cell lysates, and other biological fluids

    • Proper tissue homogenization and protein extraction protocols must be followed

    • Sample dilution is critical – concentrations must be diluted to mid-range of the kit for accurate results

  • Assay specifications:

    • Typical detection range: 0.156 ng/ml - 10 ng/ml

    • Colorimetric detection method

    • Lyophilized format requiring proper reconstitution

  • Quality controls:

    • Include both positive and negative controls

    • Generate standard curves with each assay

    • Test recombinant Olr1571 protein as a positive control, noting that detection of recombinant proteins may differ from native proteins

  • Technical limitations:

    • Kit validity is typically limited to 6 months

    • Proper storage at 4°C upon receipt is essential

    • Optimal dilutions should be determined empirically for each sample type

How can I design primers for RT-PCR detection of Olr1571?

Effective primer design for Olr1571 detection requires consideration of several factors:

  • Target specificity:

    • Design primers to unique regions of Olr1571 to avoid cross-reactivity with other olfactory receptors

    • Consider using primers spanning exon-exon junctions to prevent genomic DNA amplification

    • Verify specificity using BLAST or similar alignment tools

  • Primer recommendations:

    • Forward and reverse primers should ideally have similar melting temperatures (Tm)

    • Amplicon size should be 80-200 bp for qPCR applications

    • GC content should be 40-60% for stable annealing

  • Control considerations:

    • Include primers for housekeeping genes (e.g., GAPDH, β-actin) as internal controls

    • Consider using primers for Gαolf or AC3 to correlate with the receptor's signaling components

  • Tissue-specific considerations:

    • Be aware that Olr1571 may use different promoters and have different transcript structures in different tissues

    • Consider designing primers to detect potential 5' UTR variants, as olfactory receptors can have tissue-specific transcript structures

Initial degenerate primers targeting conserved GPCR regions were used historically to identify olfactory receptors, but gene-specific primers are now preferred for targeted Olr1571 detection .

How can I investigate the functional role of Olr1571 in non-chemosensory tissues?

Investigating the functional role of Olr1571 in non-chemosensory tissues requires multi-faceted approaches:

  • Genetic manipulation strategies:

    • Develop tissue-specific knockout models using Cre-lox systems

    • Use siRNA or shRNA for transient knockdown in cell culture models

    • Consider CRISPR-Cas9 for precise genome editing

    • Utilize transgenic reporter systems (e.g., Olr1571-IRES-tauLacZ) for expression visualization

  • Ligand identification approaches:

    • Screen potential ligands using heterologous expression systems

    • Employ calcium imaging or ELISA-based serotonin release assays to detect receptor activation

    • Consider computational approaches to predict potential ligands based on structural homology

  • Downstream signaling investigation:

    • Examine coupling with Gαolf and activation of adenylyl cyclase III (AC3)

    • Measure cAMP levels using reporter assays

    • Investigate potential alternative signaling pathways in non-olfactory tissues

    • Analyze tissue-specific protein interactions using co-immunoprecipitation

  • Physiological readouts:

    • Design tissue-specific functional assays (e.g., measuring renin release in kidney studies)

    • Use telemetry for in vivo physiological parameters

    • Consider cell migration, adhesion, or proliferation assays depending on the tissue context

The combination of these approaches provides complementary evidence for specific functions in different tissue contexts.

How does post-transcriptional regulation affect Olr1571 expression in different tissues?

The expression of Olr1571 in different tissues appears to be influenced by complex post-transcriptional regulatory mechanisms:

  • Tissue-specific transcript variants:

    • Different 5'-UTR structures have been observed for olfactory receptors in different tissues, suggesting alternative promoter usage

    • 5'-RACE experiments have demonstrated tissue-specific transcript start sites for several olfactory receptors

  • Regulatory considerations:

    • Analyze promoter regions for tissue-specific transcription factor binding sites

    • Investigate epigenetic modifications (DNA methylation, histone modifications) that may regulate tissue-specific expression

    • Consider the role of non-coding RNAs in regulating Olr1571 expression

  • Experimental approaches:

    • Use reporter gene assays with different 5' regulatory regions

    • Employ chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the Olr1571 promoter

    • Analyze tissue-specific RNA processing through RNA-seq and alternative splicing analysis

  • Developmental considerations:

    • Olr1571 expression may vary during development, as seen with other olfactory receptors (e.g., M71)

    • Temporal expression patterns should be considered alongside spatial expression patterns

Instances have been reported where the same olfactory receptor uses identical transcription start sites in multiple tissues (including olfactory epithelium, cerebral cortex, spleen, and testis), suggesting that post-transcriptional regulation may involve factors beyond promoter usage .

What are the challenges in studying Olr1571 protein-protein interactions and signaling pathways?

Investigating Olr1571 protein interactions and signaling pathways presents several technical challenges:

  • Receptor expression challenges:

    • Low endogenous expression levels in non-chemosensory tissues

    • Difficulties in heterologous expression due to poor membrane trafficking

    • Potential for non-native conformations affecting interaction studies

  • Signaling pathway determination:

    • In olfactory neurons, ORs typically signal through OR-Golf-ACIII-CNG channel pathway

    • Non-chemosensory tissues may utilize alternative G proteins or downstream effectors

    • Need to establish tissue-specific signaling components through co-expression studies

  • Methodological approaches:

    • Use proximity ligation assays to detect in situ protein interactions

    • Employ bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) for real-time interaction monitoring

    • Consider proteomic approaches like BioID or APEX2 for identifying interaction partners

  • Functional validation:

    • Develop assays to measure functional outcomes of specific interactions

    • Use pharmacological inhibitors or genetic manipulation to validate pathway components

    • Consider the temporal dynamics of signaling responses

Researchers should be aware that canonical olfactory signaling components (Golf, ACIII) have been detected alongside Olr1571 in some non-chemosensory tissues, suggesting potential conservation of signaling mechanisms across tissues .

How can I design experiments to validate the specificity of Olr1571 detection methods?

Robust validation of Olr1571 detection methods requires multiple complementary approaches:

  • Antibody validation strategies:

    • Pre-adsorption controls with recombinant Olr1571 protein

    • Comparative staining in tissues known to express or lack Olr1571

    • Western blot analysis to confirm antibody specificity based on molecular weight

    • Validation in knockout or knockdown models

    • Use of multiple antibodies targeting different epitopes

  • PCR validation approaches:

    • Sequence verification of amplification products

    • Use of positive and negative control tissues

    • Inclusion of no-template and no-reverse-transcriptase controls

    • Melting curve analysis for qPCR applications

    • Comparison with multiple primer pairs targeting different regions

  • Cross-validation between techniques:

    • Correlation between protein detection (IHC, Western blot) and mRNA detection (RT-PCR, ISH)

    • Functional validation through ligand-induced responses

    • Integration with reporter gene approaches in model systems

  • Addressing potential pitfalls:

    • Recognition that olfactory receptors share sequence homology, requiring careful validation

    • Consideration of potential cross-reactivity with other GPCRs

    • Awareness of potential alternative splice variants or protein isoforms

What controls are essential when working with recombinant Olr1571 protein?

Proper experimental design with recombinant Olr1571 requires rigorous controls:

  • Protein quality controls:

    • SDS-PAGE with Coomassie staining to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry for sequence verification

    • Circular dichroism to assess proper protein folding

    • Size-exclusion chromatography to evaluate aggregation state

  • Expression system considerations:

    • E. coli-expressed proteins may lack post-translational modifications

    • Consider mammalian or insect cell expression systems for more native-like protein

    • Use of tags (His-tag) may affect protein function and should be controlled for

  • Functional assays:

    • Include positive controls with known functional properties

    • Use denatured protein as negative control

    • Include related but distinct GPCRs to assess specificity of responses

    • Test storage conditions (temperature, freeze-thaw cycles) for effects on activity

  • Storage and handling:

    • Store according to manufacturer recommendations (typically at -20°C with 50% glycerol)

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots to maintain at 4°C for up to one week

    • Validate protein stability over time with functional assays

How can I integrate multi-omics approaches to study Olr1571 function in different tissues?

A comprehensive multi-omics strategy provides deeper insights into Olr1571 function:

  • Genomics approaches:

    • Analyze promoter regions and regulatory elements across tissues

    • Consider SNP variations that might affect expression or function

    • Use ChIP-seq to identify transcription factors regulating expression

  • Transcriptomics strategies:

    • RNA-seq to identify co-expressed genes in Olr1571-positive tissues

    • Single-cell RNA-seq to identify specific cell populations expressing Olr1571

    • Alternative splicing analysis to detect tissue-specific transcript variants

    • Compare transcriptomes before and after receptor activation

  • Proteomics methods:

    • Identify protein interaction networks through proximity labeling or co-immunoprecipitation

    • Phosphoproteomics to map downstream signaling cascades

    • Spatial proteomics to determine subcellular localization

  • Metabolomics integration:

    • Identify metabolic changes associated with receptor activation

    • Screen for endogenous ligands that might activate the receptor

    • Link receptor function to tissue-specific metabolic pathways

  • Data integration frameworks:

    • Use pathway analysis tools to integrate multi-omics data

    • Apply machine learning approaches to identify patterns across datasets

    • Develop tissue-specific models of receptor function and regulation

This integrated approach allows researchers to place Olr1571 within the broader context of cellular functions and tissue-specific signaling networks.

What are the emerging research areas for Olr1571 and related olfactory receptors?

Several cutting-edge research directions are emerging in the study of ectopically expressed olfactory receptors like Olr1571:

  • Physiological roles in non-chemosensory tissues:

    • Cardiovascular function (given expression in heart tissue)

    • Reproductive biology (given expression in testis)

    • Potential roles in cellular adhesion, migration, and regeneration (as observed with other ORs)

  • Signaling pathway elucidation:

    • Identification of tissue-specific signaling components

    • Discovery of endogenous ligands in non-olfactory contexts

    • Cross-talk with other signaling systems

  • Therapeutic targeting potential:

    • Development of selective agonists/antagonists for tissue-specific functions

    • Investigation of olfactory receptors as drug targets for non-olfactory diseases

    • Biomarker potential in health and disease states

  • Evolutionary considerations:

    • Comparative analysis of ectopic expression across species

    • Investigation of selective pressures on receptor conservation

    • Functional diversification of olfactory receptors in mammalian evolution

  • Developmental biology applications:

    • Temporal regulation during tissue development and regeneration

    • Stem cell differentiation and tissue engineering applications

    • Potential roles in cellular reprogramming

Researchers should consider these emerging directions when designing long-term research programs involving Olr1571.

How can systems biology approaches enhance our understanding of Olr1571 function?

Systems biology provides powerful frameworks for understanding Olr1571 in broader biological contexts:

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on Olr1571

    • Identify gene regulatory networks controlling expression

    • Map signaling cascades using phosphoproteomics and network inference

    • Compare networks across tissues to identify tissue-specific modules

  • Mathematical modeling:

    • Develop kinetic models of Olr1571 signaling dynamics

    • Create tissue-specific models incorporating known components

    • Use Boolean networks to predict functional outcomes of receptor activation

    • Simulate perturbations to predict experimental outcomes

  • Comparative systems approaches:

    • Compare Olr1571 networks with those of other ectopically expressed ORs

    • Analyze conservation and divergence across species

    • Identify common principles in ectopic OR function

  • Integration with phenotypic data:

    • Link molecular networks to physiological outcomes

    • Connect receptor function to tissue-specific phenotypes

    • Develop predictive models relating molecular mechanisms to function

  • Technological considerations:

    • Use high-content imaging for spatial mapping of network components

    • Apply multiplexed assays to measure multiple network nodes simultaneously

    • Consider temporal dynamics in experimental design and modeling

These systems approaches provide a more holistic understanding of Olr1571 function beyond isolated molecular mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.