Recombinant Rat Oligosaccharyltransferase complex subunit OSTC (Ostc)

Shipped with Ice Packs
In Stock

Description

Introduction

The oligosaccharyltransferase (OST) complex is a highly conserved multi-subunit enzyme responsible for N-glycosylation, a fundamental post-translational modification crucial for protein folding, quality control, and trafficking in the endoplasmic reticulum (ER) . In mammalian cells, two distinct OST complexes exist, each containing either STT3A or STT3B as the catalytic subunit, along with several accessory proteins . One such accessory protein is the Recombinant Rat Oligosaccharyltransferase complex subunit OSTC (Ostc), also known as DC2 . OSTC is a specific component of the STT3A-containing OST complex .

Function and Significance

OSTC is a non-catalytic subunit of the OST complex that is essential for maximal enzyme activity . The OST complex catalyzes the transfer of a glycan (Glc3Man9GlcNAc2 in eukaryotes) from dolichol-pyrophosphate to asparagine residues within the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains, initiating protein N-glycosylation . This process occurs co-translationally, with the OST complex associating with the Sec61 complex at the translocon channel in the ER membrane, facilitating protein translocation .

Role in N-Glycosylation

N-glycosylation is vital for protein folding, stability, and function . The OST complex, including OSTC, ensures the accurate and efficient transfer of glycans to nascent proteins . This modification is critical for various cellular processes, including protein quality control, trafficking, signal transduction, and cell-to-cell communication .

Involvement in Disease

Given the crucial roles of N-glycosylation and the OST complex, deficiencies in OST subunits can lead to complex genetic disorders . While specific diseases directly linked to OSTC mutations are not extensively documented, its role in the OST complex suggests that its dysfunction could contribute to glycosylation-related disorders .

Interaction with Amyloid Precursor Protein (APP)

OSTC may be involved in the N-glycosylation of APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage of APP by enhancing endoproteolysis of PSEN1 . This suggests a potential role for OSTC in Alzheimer's disease and other neurodegenerative conditions involving APP processing.

OST and ERAD

Recent studies suggest that the OST complex, including its subunits like OSTC, may play a role in ER-associated degradation (ERAD) . OST interacts with the E3 ligase HRD1 and affects retrotranslocation, indicating its involvement in the degradation of misfolded proteins .

Functional Comparison of Human, Mouse, and Rat Orthologs

FeatureHuman OCT1 (hOCT1)Mouse Oct1 (mOct1)Rat Oct1 (rOct1)
Km for MPP (µM)73 ± 736 ± 1357 ± 5
IC50 for Decynium22 (µM)12.1 ± 0.85.3 ± 0.410.5 ± 0.4

This table highlights the functional similarities and differences between human, mouse, and rat organic cation transporter 1 (OCT1) orthologs, demonstrating the interactions of drugs and pesticides . The data indicates a strong functional correlation between the three species, which is relevant when extrapolating animal data to humans .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ostc; Dc2; Oligosaccharyltransferase complex subunit OSTC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ostc
Target Protein Sequence
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function

Recombinant Rat Oligosaccharyltransferase complex subunit OSTC (Ostc) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation, a cotranslational process. The OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity. Ostc may be involved in N-glycosylation of APP (amyloid-beta precursor protein) and modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.

Database Links
Protein Families
OSTC family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of OSTC in the oligosaccharyltransferase complex?

    OSTC (Oligosaccharyltransferase Complex Non-Catalytic Subunit) is a specific component of the STT3A-containing form of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of the defined glycan Glc₃Man₉GlcNAc₂ from dolichol-pyrophosphate to asparagine residues within Asn-X-Ser/Thr consensus motifs in nascent polypeptide chains. This represents the first critical step in protein N-glycosylation . OSTC functions non-catalytically within the complex, where N-glycosylation occurs cotranslationally as the OST complex associates with the Sec61 complex at the channel-forming translocon that mediates protein translocation across the endoplasmic reticulum (ER) . Research indicates that all subunits, including OSTC, are required for maximal enzymatic activity of the complex.

  • How is recombinant rat OSTC typically expressed and purified for research purposes?

    Recombinant rat OSTC is commonly expressed in bacterial systems such as E. coli, with expression vectors carrying the complete coding region. For optimal expression and purification:

    • Transform expression vectors into competent E. coli cells (typically SDB1 or CLM24 strains)

    • Culture in appropriate media (2YPTG broth is common: 10 g/L Yeast extract, 16 g/L Tryptone, 5 g/L NaCl, 7 g/L K₂HPO₄, 3 g/L KH₂PO₄, 18 g/L glucose; pH 7.2)

    • Induce expression with 1 mM IPTG when cultures reach OD₆₀₀ 0.5-0.6

    • Harvest cells after appropriate expression time

    • Purify using affinity chromatography methods, often with His-tagging strategies

    The purification typically involves cell lysis, followed by IMAC (immobilized metal affinity chromatography) if His-tagged, with subsequent polishing steps such as ion-exchange chromatography .

  • What are the key experimental considerations when working with recombinant rat OSTC?

    Several experimental factors are critical when working with recombinant rat OSTC:

    • Protein stability: Store at -20°C or -80°C, avoiding repeated freeze-thaw cycles

    • Buffer conditions: Typically 20 mM Tris-HCl based buffer, pH 8.0, sometimes with glycerol for stability

    • Co-expression factors: Consider co-expressing with other OST complex components for functional studies

    • Glycosylation status: Unlike mammalian-expressed OST components, E. coli-expressed recombinant OSTC lacks post-translational modifications, which may affect functional studies

    • Purity assessment: Analyze purity via SDS-PAGE, aiming for >90% purity

    • Activity verification: Functional assays should include in vitro glycosylation of test substrates

  • How does rat OSTC differ from human OSTC in structure and function?

    While both rat and human OSTC serve similar functions in the OST complex, there are notable differences:

    FeatureRat OSTCHuman OSTC
    Amino acid sequence homologyReference~85% identity with rat OSTC
    Protein binding partnersPreferential binding to rat-specific interactorsMay interact differently with human proteins
    Glycosylation patternsShows species-specific glycosylation when expressed in native tissueHuman-specific glycosylation patterns
    Function in glycan transferMay show species-specific preferences for glycan structuresCan process a wider range of glycan structures

    These differences can be significant when designing cross-species experiments or when using rat models for human disease studies. When expressed in identical systems (e.g., CHO cells), both proteins show similar biochemical properties but may exhibit differential interactions with species-specific binding partners .

Advanced Research Questions

  • What techniques are most effective for studying OSTC-dependent protein glycosylation in vitro?

    For in-depth analysis of OSTC-dependent glycosylation, several specialized techniques have proven effective:

    Cell-Free Glycosylation System (TiOP - Three-in-One Pot):
    This simplified assay allows rapid screening of OST activity without the complexity of cellular expression systems.

    Methodology:

    1. Express and purify OSTC alongside other OST components

    2. Express and purify acceptor protein (EPA with 10 sequons or AcrA with 2 glycosylation sequons)

    3. Express desired glycan donors

    4. Combine purified components in a cell-free reaction

    5. Detect glycosylation via western blot analysis

    Advantages: The TiOP approach allows testing of glycan/carrier protein combinations without the need for optimizing co-expression in a single cell, thus enabling rapid screening of OST functionality .

    Alternative techniques:

    • Mass spectrometry-based site-specific glycosylation analysis

    • Protein-Glycan Coupled Technology (PGCT)

    • Radioactive labeling with [³H]-mannose for quantitative assessment

  • How does OSTC interact with other proteins in the CALR-OSTC-protein folding pathway, and what implications does this have for hepatocarcinogenesis?

    OSTC exhibits important protein-protein interactions in the CALR-OSTC-protein folding pathway with significant implications for hepatocarcinogenesis:

    Key Interactions:

    • OSTC binds directly to cell cycle regulators CDK2, CDK4, CyclinD1, and cyclinE

    • These binding interactions are altered by miR-1307, which promotes CALR expression while inhibiting OSTC

    • OSTC also binds to H-Ras, PKM2, and PLK1, regulating their activity

    • OSTC interacts with autophagy-related protein ATG4, influencing autophagy regulation

    Experimental Evidence:
    Co-immunoprecipitation (IP) analysis demonstrated that miR-1307 significantly decreases the binding ability of OSTC to CDK2, CDK4, CyclinD1, and cyclinE, while enhancing CALR binding to these proteins .

    Hepatocarcinogenesis Implications:
    When OSTC expression is inhibited by miR-1307:

    • Expression of tumor suppressors p21WAF1/CIP1, GADD45, pRB, and p18 decreases

    • Expression of oncogenic ppRB and PCNA increases

    • Activities of H-Ras, PKM2, and PLK1 increase

    • Autophagy is reduced through decreased ATG4-LC3-ATG3-ATG7-ATG5-ATG16L1-ATG12-ATG9-Beclin1 pathway activity

    These alterations collectively promote hepatocarcinogenesis, and rescue experiments confirm that both CALR knockdown and excessive OSTC expression can abrogate the carcinogenic function of miR-1307 .

  • What role does OSTC play in ER-associated degradation (ERAD), and how can this function be experimentally distinguished from its glycosylation activity?

    OSTC has a dual role in both glycosylation and ER-associated degradation (ERAD):

    ERAD Function:

    • OST, including the OSTC subunit, is involved in targeting misfolded proteins for ERAD

    • It interacts with misfolded ER proteins and participates in their retrotranslocation to cytosolic proteasomes

    • OSTC specifically engages with both glycoproteins and non-glycosylated proteins in the ERAD pathway

    • The complex interacts with E3 ligase HRD1 and impacts retrotranslocation processes

    Experimental Differentiation from Glycosylation Activity:

    To distinguish OSTC's ERAD function from its glycosylation activity:

    1. Selective manipulation: Overexpress or partially knock down OSTC under conditions that do not affect glycosylation but interfere with ERAD

    2. Model protein systems: Study effects on:

      • Type I misfolded membrane proteins (e.g., BACE476)

      • Type II misfolded membrane proteins (e.g., asialoglycoprotein receptor H2a)

      • Soluble luminal misfolded glycoproteins (e.g., α1-antitrypsin NHK variant)

    3. Mechanistic analysis: OSTC appears involved in late ERAD stages, potentially assisting retrotranslocation by contributing to membrane distortion for protein dislocation

    This dual functionality suggests OSTC is part of quality control mechanisms beyond its canonical glycosylation role.

  • How can researchers optimize a cell-free glycosylation screening system to evaluate OSTC functionality with different glycan substrates?

    A cell-free glycosylation screening system offers efficient evaluation of OSTC functionality with various glycan substrates. Here's an optimized approach based on current research:

    System Components:

    • Purified OSTC (and other OST components)

    • Acceptor protein (EPA with multiple glycosylation sequons)

    • Various glycan donors with diverse reducing end sugars

    Optimization Protocol:

    1. Glycan Source Preparation:

      • Native bacterial glycans extracted from appropriate strains

      • Recombinantly expressed glycans from engineered E. coli strains

      • Use diverse glycans with different reducing end sugars (GlcNAc, DiNAcBac, GalNAc, Gal, Qui4NFm)

    2. OST Titration:

      • Perform initial OST titration experiments to determine optimal enzyme volume

      • Select volumes that avoid inhibitory effects from cell lysis components

    3. Reaction Conditions:

      • Buffer: Standard buffer supplemented with essential cofactors

      • Temperature: 30-37°C

      • Time: 2-4 hours

    4. Analysis Methods:

      • Western blot detection of glycosylated products

      • Densitometry analysis for semi-quantitative assessment

      • For better separation, enumerate polymerized glycan coupled to acceptor protein sequons

    5. Data Interpretation:

      • Cross-comparison of results requires consideration of sequon numbers

      • For mammalian-like glycosylation, focus on OSTs with high amino acid similarity to mammalian counterparts

    This optimized system allows rapid screening of OST, glycan, and carrier protein combinations, facilitating research on glycosylation mechanisms and potentially accelerating glycoconjugate vaccine development .

  • What are the consequences of site-specific glycosylation differences between recombinant rat OSTC expressed in bacterial vs. mammalian systems?

    The expression system significantly affects site-specific glycosylation patterns of recombinant rat OSTC, with important research implications:

    Expression System Comparison:

    FeatureBacterial Expression (E. coli)Mammalian Expression (CHO cells)
    N-glycosylationAbsentPresent with complex patterns
    Protein foldingMay have altered tertiary structureNative-like folding
    Functional assaysLimited by lack of PTMsMore physiologically relevant
    ImmunogenicityPotentially higherMore similar to native protein
    StabilityOften lowerGenerally higher

    Specific Glycosylation Consequences:

    1. Structural Impacts:

      • Bacterial-expressed OSTC lacks N-glycans that may stabilize protein-protein interactions

      • Mammalian-expressed OSTC contains site-specific glycans that contribute to proper complex formation

    2. Functional Differences:

      • In vitro activity may be preserved in bacterial expression systems

      • In vivo activity is often significantly higher for mammalian-expressed proteins due to proper glycosylation

      • Example: When comparing rat recombinant FSH with natural pituitary FSH, in vivo activities were 8824 and 3051 IU/mg respectively, illustrating the impact of glycosylation differences

    3. Experimental Considerations:

      • For structural studies, bacterial expression may be sufficient

      • For functional studies requiring native-like activity, mammalian expression is preferred

      • When using in disease models, consider that glycosylation patterns may affect targeting, half-life, and biological activity

    These differences highlight the importance of selecting the appropriate expression system based on experimental goals and requirements for recombinant rat OSTC research.

  • How does the interplay between OSTC and CALR influence autophagy regulation, and what methods can be used to study this interaction?

    The OSTC-CALR interaction significantly impacts autophagy regulation through multiple mechanisms:

    Regulatory Mechanisms:

    • OSTC normally binds to autophagy-related protein ATG4

    • When miR-1307 is overexpressed, OSTC binding to ATG4 decreases while CALR binding to ATG4 increases

    • This altered binding pattern affects the ATG4-LC3-ATG3-ATG7-ATG5-ATG16L1-ATG12-ATG9-Beclin1 autophagy pathway

    • The disruption leads to reduced autophagy rates and altered expression of cancer-related genes

    Experimental Methods to Study This Interaction:

    1. Co-Immunoprecipitation (Co-IP) Analysis:

      • Use anti-OSTC and anti-CALR antibodies to pull down respective proteins

      • Analyze binding partners (especially ATG4) via western blotting

      • Quantify interaction strength through densitometry analysis

    2. LC3 HiBiT-Reporter Assay:

      • Measures autophagy rate (inversely proportional to reporter value)

      • Can demonstrate autophagy reduction when OSTC-ATG4 binding is disrupted

      • Data shows significant autophagy reduction in miR-1307 overexpression (52.26 ± 11.0 versus 319.59 ± 23.77, p = 0.000404)

    3. Rescue Experiments:

      • Combine miR-1307 overexpression with either CALR knockdown or OSTC overexpression

      • Analyze effects on autophagy markers and cancer phenotypes

      • Data shows that both interventions can restore normal autophagy patterns

    4. Autophagy Protein Binding Analysis:

      • Examine binding between key autophagy proteins (LC3 with ATG3/ATG7)

      • Assess complex formation (ATG5 with ATG16L1/ATG12/ATG9/ATG7)

      • Quantify autophagy marker expression (active LC3II, Beclin1)

    Using these methods, researchers have demonstrated that disruption of OSTC-CALR balance significantly impacts autophagy, with implications for pathological processes like hepatocarcinogenesis .

Research Methodology and Troubleshooting

  • What are the most common challenges when expressing recombinant rat OSTC in different host systems, and how can they be addressed?

    Expression of recombinant rat OSTC presents system-specific challenges:

    Bacterial Expression Systems (E. coli):

    ChallengeSolution
    Low expression levels (~0.1% of total soluble protein)Optimize codon usage; use strong promoters (T7); adjust induction conditions
    Protein misfolding/inclusion bodiesLower induction temperature (16-25°C); use solubility tags (SUMO, MBP); include folding chaperones
    Lack of post-translational modificationsAccept limitation for structural studies; switch to eukaryotic systems for functional studies
    Endotoxin contaminationImplement additional purification steps; use specialized endotoxin removal methods

    Mammalian Expression Systems (CHO, HEK293):

    ChallengeSolution
    Complex glycosylation heterogeneityGlycosylation inhibitors; engineered CHO lines with humanized glycosylation
    Lower protein yieldOptimize transfection; use stable cell lines; implement fed-batch cultures
    System-specific glycan structuresCompare with native rat OSTC; characterize using mass spectrometry
    Cost and time requirementsBalance need for authentic PTMs with resource constraints

    Plant-Based Expression Systems (N. benthamiana):

    ChallengeSolution
    Non-mammalian glycosylationGlycoengineering to humanize N-glycan patterns
    High levels of protein aggregationOptimize extraction conditions; include stabilizing buffers
    Paucimannosidic structuresDown-regulate β-hexosaminidases (HEXOs) using RNA interference
    Low glycan occupancyMonitor site-specific glycosylation; optimize expression conditions

    The choice of expression system should align with research objectives, balancing authentic structure/function with practical considerations of yield, cost, and time .

  • How can researchers effectively design experiments to investigate the role of OSTC in disease models, particularly in hepatocarcinogenesis?

    Designing robust experiments to study OSTC in hepatocarcinogenesis requires strategic approaches:

    In Vitro Experimental Design:

    1. OSTC Manipulation Strategies:

      • Overexpression: Use rLV-OSTC vectors in hepatocyte cell lines

      • Knockdown: Employ pGFP-V-RS-OSTC for RNA interference

      • Compare with CALR manipulation (overexpression/knockdown)

    2. Functional Assays:

      • Proliferation: MTT assay at multiple timepoints (24h, 48h)

      • Colony formation: Quantify percentage (e.g., 30.59 ± 3.50% vs. 62.01 ± 5.58%)

      • Cell cycle analysis: Flow cytometry with PI staining

      • Protein binding: Co-IP for CDK2, CDK4, CyclinD1, cyclinE interactions

    3. Molecular Pathway Analysis:

      • Western blotting for p21WAF1/CIP1, GADD45, pRB, p18, ppRB, PCNA

      • Activity assays for H-Ras, PKM2, PLK1

      • Autophagy assessment via LC3 HiBiT-reporter assay

    In Vivo Experimental Design:

    1. Animal Models:

      • Xenograft models using OSTC-manipulated cells

      • Track tumor appearance time (e.g., 10.5 ± 1.9 days vs. 6.3 ± 1.06 days)

      • Measure tumor weight (e.g., 0.409 ± 0.104g vs. 0.953 ± 0.121g)

    2. Considerations for Using Rat Models:

      • Use SRG rats (Sprague Dawley-Rag2) for immunodeficient models

      • Consider heterogeneous stock (HS) rats for genetic diversity

      • Include appropriate controls (rLV empty vector)

    3. Histological Analysis:

      • H&E staining for tumor differentiation

      • Immunohistochemistry for PCNA and other markers

    Data Analysis Recommendations:

    • Apply appropriate statistical tests (t-test, ANOVA)

    • Report p-values with significance thresholds (p < 0.01, p < 0.05)

    • Present data with standard deviations/errors

    • Consider genetic background effects in animal models

    This comprehensive approach enables rigorous investigation of OSTC's role in hepatocarcinogenesis, from molecular mechanisms to in vivo relevance .

  • What are the key considerations for designing glycosylation sequons when studying the function of rat OSTC in recombinant protein systems?

    Designing effective glycosylation sequons for rat OSTC functional studies requires careful consideration of multiple factors:

    Consensus Sequence Optimization:

    1. Core Sequon Structure:

      • Standard N-X-S/T motif (where X ≠ proline)

      • Enhanced efficiency with Asp/Glu at -2 position (D/E-X-N-X-S/T)

      • Preference for threonine over serine in the +2 position improves catalytic efficiency

    2. Flanking Residues Impact:

      • Avoid bulky hydrophobic residues near the sequon

      • Positive charge amino acids at -1 position may reduce efficiency

      • Extended sequons (e.g., Q-X-N-X-T) can enhance glycosylation in some contexts

    Experimental Design Considerations:

    1. Acceptor Protein Selection:

      • EPA with 10 sequons provides high sensitivity for detection

      • AcrA with 2 glycosylation sequons offers more controlled assessment

      • Consider protein structure's impact on sequon accessibility

    2. Sequon Positioning:

      • Place on flexible, solvent-exposed regions

      • Avoid β-sheet structures which can inhibit glycan transfer

      • Consider distance between multiple sequons (minimum 12-15 residues apart)

    3. Context-Specific Optimization:

      • For PglB systems, D/E-X-N-X-S/T motif with threonine is optimal

      • Mutational analysis shows that threonine at +2 position improves catalytic efficiency compared to serine

      • Context-dependent efficiency may vary between different OST complexes

    4. Sequon Number Effects:

      • Multiple sequons may create steric hindrance effects

      • Higher sequon number increases detection sensitivity but may complicate interpretation

      • When comparing glycosylation efficiencies, consider sequon numbers in acceptor proteins

    These considerations will help optimize experimental design when studying rat OSTC function, ensuring more reliable and interpretable results from glycosylation assays .

  • How do researchers address the challenges of species-specific differences when using recombinant rat OSTC in translational research toward human applications?

    Addressing species-specific differences between rat and human OSTC in translational research requires systematic approaches:

    Comparative Analysis Strategies:

    1. Sequence-Function Relationships:

      • Perform sequence alignments to identify conserved vs. divergent regions

      • Focus on functional domains with high conservation across species

      • Map species-specific residues to three-dimensional structures

    2. Protein-Protein Interaction Mapping:

      • Compare binding partners between rat and human OSTC

      • Identify conserved vs. species-specific interactions

      • Use cross-species co-immunoprecipitation to test interaction conservation

    Experimental Translation Approaches:

    1. Parallel Testing Systems:

      • Test both rat and human OSTC in identical experimental conditions

      • Compare responses to pathway modulators across species

      • Generate rat/human chimeric proteins to pinpoint functionally divergent regions

    2. Expression System Considerations:

      • Express both proteins in the same host (e.g., CHO cells)

      • Compare post-translational modifications using mass spectrometry

      • Assess functional activity using identical reporter systems

    Translational Research Solutions:

    1. Humanized Rat Models:

      • Use transgenic rats expressing human OSTC

      • Evaluate species-specific pathway responses in vivo

      • Compare disease progression patterns in native vs. humanized models

    2. Predictive Algorithms:

      • Develop computational models to predict human responses from rat data

      • Incorporate structural and functional conservation metrics

      • Validate predictions with focused human cell experiments

    3. Glycoengineering Approaches:

      • Engineer expression systems to produce human-like glycosylation patterns

      • Use specialized cell lines with humanized N-glycosylation capability

      • Evaluate functional consequences of glycan differences

    These approaches help bridge the translational gap between rat and human systems, enabling more accurate prediction of human responses from rat-based experimental data .

  • What advanced analytical techniques are most effective for characterizing the structural and functional properties of recombinant rat OSTC?

    Comprehensive characterization of recombinant rat OSTC requires integration of multiple advanced analytical techniques:

    Structural Characterization:

    1. Mass Spectrometry-Based Approaches:

      • Site-Specific Glycosylation Analysis:

        • Liquid-chromatography-mass spectrometry (LC-MS)

        • Identification of glycan compositions by detected masses

        • Classification into oligomannose, hybrid, complex, or truncated structures

      • Protein Sequencing:

        • N-terminal sequencing via Edman degradation

        • C-terminal sequencing using carboxypeptidase A digestion

        • Comparison with predicted sequences from cDNA

    2. Spectroscopic Methods:

      • Microfluidic Modulation Spectroscopy (MMS):

        • Analysis of protein secondary structure

        • Comparison between different expression systems

      • Circular Dichroism (CD):

        • Assessment of secondary structural elements

        • Thermal stability measurements

    Functional Characterization:

    1. Glycosylation Activity Assays:

      • Cell-Free Glycosylation Systems:

        • Three-in-One Pot (TiOP) approach for rapid screening

        • Assessment of glycosylation efficiency with different substrates

      • Protein-Glycan Coupled Technology (PGCT):

        • Co-expression of glycan biosynthesis components

        • In vivo glycosylation assessment

    2. Protein-Protein Interaction Analysis:

      • Co-Immunoprecipitation (Co-IP):

        • Identification of binding partners (CDK2, CDK4, CyclinD1, cyclinE)

        • Quantification of binding strength

      • Surface Plasmon Resonance (SPR):

        • Real-time binding kinetics measurements

        • Determination of association/dissociation constants

    3. Electron Microscopy:

      • Transmission Electron Microscopy (TEM):

        • Visualization of protein complexes

        • Assessment of structural integrity

      • Cryo-Electron Microscopy:

        • Near-atomic resolution structures

        • Visualization of OSTC within the OST complex

    Integrated Approaches:

    1. Multi-Dimensional Data Integration:

      • Combine structural and functional datasets

      • Correlate sequence variations with functional outcomes

      • Map glycosylation patterns to activity levels

    2. Comparative Analysis:

      • Between expression systems (bacterial vs. mammalian)

      • Between species (rat vs. human)

      • Between wild-type and mutant variants

    These techniques collectively provide comprehensive insights into the structural features and functional capabilities of recombinant rat OSTC, enabling deeper understanding of its biological roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.