Recombinant Rat Omega-3 fatty acid receptor 1 (O3far1)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant O3far1 is widely used in ELISA kits and in vitro assays to study receptor-ligand interactions and signaling mechanisms.

ParameterSpecificationSource
Detection Range0.625–40 ng/mL (Rat ELISA)
Sensitivity0.322 ng/mL
Intra-Assay Precision5.4% CV
Inter-Assay Precision8.5% CV
Sample TypesSerum, plasma, tissue homogenates

Key Uses

  • Quantifying O3far1 in obesity models to assess metabolic dysregulation .

  • Investigating anti-inflammatory effects in macrophages and adipocytes .

Anti-Inflammatory Mechanisms

Recombinant O3far1 mediates omega-3 fatty acid (e.g., DHA, EPA) signaling through two pathways:

  1. Gq/11-coupled pathway: Regulates intracellular calcium flux .

  2. β-arrestin 2-dependent pathway: Inhibits TAK1/TAB1 complex formation, suppressing NF-κB and JNK inflammatory cascades .

Metabolic Regulation

  • Enhances insulin sensitivity by reducing macrophage-induced tissue inflammation .

  • Modulates adipocyte differentiation and lipid metabolism via PPAR-γ upregulation .

Interaction Partners and Subcellular Localization

InteractionFunctional OutcomeSource
ARRB2 (β-arrestin 2)Mediates anti-inflammatory signaling
TAB1/TAK1Inhibition reduces pro-inflammatory cytokines
PPAR-γUpregulation improves adipocyte function

Subcellular Localization: Primarily located on the plasma membrane, with internalization into endocytic vesicles upon DHA stimulation .

Challenges and Future Directions

While recombinant O3far1 has advanced mechanistic studies, limitations include:

  • Variable ligand specificity across species (e.g., human vs. rat) .

  • Need for in vivo models to validate therapeutic targeting .

Recent clinical trials highlight its potential in metabolic syndrome, with omega-3 supplementation showing dose-dependent PPAR-γ activation .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
Ffar4; Gpr120; O3far1; Free fatty acid receptor 4; G-protein coupled receptor 120; Omega-3 fatty acid receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSPECAQTTGPGPSRTPDQVNRTHFPFFSDVKGDHRLVLSVLETTVLGLIFVVSLLGNVC ALVLVVRRRRRGATVSLVLNLFCADLLFTSAIPLVLVVRWTEAWLLGPVVCHLLFYVMTM SGSVTILTLAAVSLERMVCIVRLRRGLSGPGRRTQAALLAFIWGYSALAALPLCILFRVV PQRLPGGDQEIPICTLDWPNRIGEISWDVFFVTLNFLVPGLVIVISYSKILQITKASRKR LTLSLAYSESHQIRVSQQDYRLFRTLFLLMVSFFIMWSPIIITILLILIQNFRQDLVIWP SLFFWVVAFTFANSALNPILYNMSLFRSEWRKIFCCFFFPEKGAIFTETSIRRNDLSVIS T
Uniprot No.

Target Background

Function

G-protein-coupled receptor 120 (GPR120) is a receptor for long-chain fatty acids (LCFAs) playing a crucial role in adipogenesis, energy metabolism, and inflammation. It signals through G-protein and β-arrestin pathways. LCFA binding activates phosphoinositidase C-linked G proteins (GNAQ and GNA11), triggering cellular responses via second messenger pathways, including intracellular calcium mobilization, cAMP modulation, and MAPK activation. Following LCFAs binding, GPR120 associates with β-arrestin 2 (ARRB2), an adapter protein mediating downstream signaling and receptor endocytosis. GPR120 is vital in regulating adipocyte proliferation and differentiation in response to dietary fats. In perivascular preadipocytes, it acts as a receptor for omega-3 polyunsaturated fatty acids (PUFAs) at the primary cilium, initiating adipogenesis through cAMP and CTCF-dependent chromatin remodeling, leading to adipogenic gene activation and cell cycle entry. It promotes brown and beige adipocyte differentiation potentially through autocrine and endocrine FGF21 functions. GPR120 contributes to brown adipose tissue thermogenic activation and white adipose tissue browning by initiating intracellular calcium signaling, resulting in mitochondrial depolarization, fission, and increased respiration. This stimulates fatty acid uptake and oxidation, alongside UCP1-mediated thermogenesis, ultimately reducing fat mass. It regulates bone marrow mesenchymal stem cell differentiation into osteoblasts or adipocytes by modulating integrin expression. GPR120 regulates hormone secretion and appetite in response to dietary fats, stimulating GIP, GLP-1, and GCG secretion while inhibiting glucose-induced SST secretion. It mediates LCFAs' inhibition of ghrelin (GHRL) secretion. In taste buds, it contributes to dietary fatty acid sensing. In inflammation, it promotes anti-inflammatory M2 macrophage differentiation in adipose tissue, mediating the anti-inflammatory effects of omega-3 PUFAs by inhibiting NLRP3 inflammasome activation via interaction with ARRB2 and inhibition of TAK1/TAB1 and NLRP3. This results in decreased proinflammatory cytokine release. GPR120 also mediates the anti-apoptotic effects of LCFAs.

Gene References Into Functions
  1. GPR120 expression is observed in interstitial and spermatogenic cells. PMID: 28192519
  2. GPR120 expression and insulinotropic effects are altered in obesity and diabetes, potentially mediated by PPARγ. PMID: 27980130
  3. A GPR120-mediated anti-inflammatory pathway in intestinal epithelial cells has therapeutic implications for intestinal inflammatory disorders. PMID: 26791484
  4. DHA's metabolic benefits are attributed to glucose regulation via the GPR120-mediated AMPK pathway in skeletal muscle. PMID: 26134561
  5. GPR120 plays a role in TPA-induced cell motility in WB-F344 cells. PMID: 25380627
  6. Widespread GPR120 expression in the gut epithelium doesn't confirm a major role in GLP-1 secretion regulation. PMID: 24520357
  7. Rat GPR120, a G-protein-coupled receptor for free fatty acids, may play a role in FFA-associated physiological responses. PMID: 18320172
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is Omega-3 Fatty Acid Receptor 1 (O3far1) and what are its alternative nomenclatures?

Omega-3 Fatty Acid Receptor 1 (O3far1) is a G-protein coupled receptor that functions as a receptor for medium and long-chain free fatty acids, particularly omega-3 fatty acids. It is also known as G-protein coupled receptor 120 (Gpr120) and Gpr129 in some literature. The receptor signals through a G(q)/G(11)-coupled pathway and plays crucial roles in various physiological processes including inflammation modulation, lipid metabolism, and cardiovascular function . This receptor is part of the rhodopsin family of G-protein coupled receptors and participates in essential anti-inflammatory responses and insulin sensitization mechanisms .

What biological samples can be used to study O3far1 expression in rats?

O3far1 expression can be studied in various rat biological samples including:

  • Serum and plasma

  • Tissue homogenates (particularly from adipose tissue, colon, and macrophages)

  • Cell culture supernatants from rat cell lines

  • Isolated primary cells

The choice of sample depends on the specific research question. For quantitative analysis, sandwich ELISA assays can detect O3far1 with a sensitivity of approximately 0.322ng/mL and a detection range of 0.625-40ng/ml in these sample types .

What are the main functions of O3far1 in rat physiological systems?

O3far1 serves several critical physiological functions in rat models:

  • Acts as the primary receptor for omega-3 fatty acids, particularly EPA and DHA

  • Mediates robust anti-inflammatory effects, especially in macrophages and adipocytes

  • Regulates TAK1 inhibition through a beta-arrestin 2 (ARRB2)/TAB1 dependent mechanism

  • Participates in insulin signaling and glucose metabolism

  • Contributes to cardiovascular regulation

  • May influence taste perception for fatty acids

These functions make O3far1 a significant target in research related to metabolic disorders, inflammation-mediated conditions, and cardiovascular health .

What methodological approaches are most effective for studying O3far1 signaling pathways in rat tissue samples?

The most effective methodological approaches for studying O3far1 signaling pathways in rat tissues involve a combination of techniques:

  • Tissue preparation protocol:

    • Immediate tissue collection and rinsing with cold PBS containing indomethacin (5.6 μg/mL)

    • Segmentation of tissues (particularly relevant for colon studies: proximal, transverse, distal)

    • Snap freezing in liquid nitrogen

    • Pulverization of frozen tissue followed by homogenization in cold PBS with indomethacin

    • Sonication in ice water (20s sonication, 20s cooling cycles for 3 minutes)

    • Protein concentration determination using Bradford assay

  • Signaling pathway analysis:

    • Western blotting for phosphorylation states of downstream effectors

    • Immunoprecipitation to detect protein-protein interactions (particularly for beta-arrestin 2/TAB1 interactions)

    • RT-qPCR for transcriptional targets of the signaling pathway

    • Pharmacological inhibition studies to determine pathway dependencies

  • Quantitative assessment:

    • ELISA-based quantification of O3far1 (detection range 0.625-40ng/ml)

    • Linear mixed effect regression models that account for tissue variability and batch effects

How do O3far1 expression patterns differ across rat tissue types, and what are the implications for experimental design?

O3far1 expression demonstrates significant tissue-specific variations that have important implications for experimental design. Based on comprehensive tissue analyses:

Tissue TypeRelative O3far1 ExpressionKey Considerations for Researchers
Adipose tissueHighPrimary site for metabolic effects; recommended for insulin sensitivity studies
Colon segmentsVariable (proximal>transverse>distal)Section-specific analysis required; homogenization methods critical
MacrophagesHigh (especially when activated)Central to anti-inflammatory mechanism studies
Pancreatic tissueModerateImportant for diabetes model studies
Taste budsDetectableRelevant for sensory perception studies

These expression patterns necessitate careful experimental design decisions:

  • Studies focusing on metabolic effects should prioritize adipose tissue samples

  • Inflammatory response studies should include macrophage isolation protocols

  • Colon-based studies must account for regional variations through appropriate sectioning and statistical models that incorporate section as a factor variable

  • Batch effects should be controlled for in all quantitative analyses

What are the key factors to consider when designing dietary interventions to study O3far1 in rat models?

When designing dietary interventions to study O3far1 in rat models, researchers should consider:

  • Diet formulation precision:

    • Maintain constant total fat content (e.g., 34% of calories) while manipulating EPA:ω6 ratios

    • Verify fatty acid composition of experimental diets using GC-MS

    • Stabilize oils against oxidation using appropriate antioxidants (e.g., mixed tocopherols)

    • Use appropriate control diets (e.g., modified AIN93-G diet)

  • Intervention timeline:

    • Allow for acclimation period (typically one week) before experimental diet introduction

    • Consider intervention duration based on endpoint measures (five weeks demonstrated measurable changes in O3far1 signaling)

    • Monitor body weight weekly to assess potential confounding effects

  • Statistical design elements:

    • Implement completely randomized block designs

    • Plan for balanced analytical batches

    • Include appropriate sample sizes based on power analysis

    • Design must account for clustering within tissue sections from the same animal

  • Sample collection standardization:

    • Consider whether fasting status is relevant (some studies preserve colon biology by avoiding fasting)

    • Standardize collection procedures using cold buffers with stabilizing agents

    • Implement consistent timing for tissue collection

What are the recommended approaches for making O3far1 research data more FAIR (Findable, Accessible, Interoperable, Reusable)?

To enhance the FAIR principles in O3far1 research:

  • Data structure recommendations:

    • Implement standardized templates for experimental data tables

    • Include comprehensive metadata for all samples and measurements

    • Define clear ontologies for tissue types, experimental conditions, and outcomes

    • Document all processing steps from sample collection to final analysis

  • Data sharing practices:

    • Deposit raw data in appropriate repositories with persistent identifiers

    • Use machine-readable formats that preserve relationships between experimental variables

    • Include detailed methodological descriptions that enable reproduction

    • Consider upstream implementation of FAIR principles during experimental design rather than attempting compliance after completion

  • Integration approaches:

    • Develop data models that account for the multifactorial nature of O3far1 research

    • Implement dimensional modeling approaches similar to "bus architecture" for integrating clinical and research data

    • Use standardized identification systems for experimental samples and conditions

    • Ensure compatibility with existing bioinformatics infrastructures

What are common challenges in O3far1 detection assays and how can they be addressed?

Researchers frequently encounter several challenges when working with O3far1 detection assays:

  • Sensitivity limitations:

    • Problem: Standard assays may not detect low expression levels in certain tissues

    • Solution: Employ signal amplification techniques or concentrate samples; use ELISA kits with documented sensitivity of at least 0.322ng/mL

  • Cross-reactivity concerns:

    • Problem: Antibodies may cross-react with related GPCRs

    • Solution: Validate antibody specificity using positive and negative controls; consider knockout validation where possible

  • Tissue heterogeneity:

    • Problem: Variable expression across tissue sections leads to inconsistent results

    • Solution: Implement consistent tissue sectioning protocols; use statistical models that account for section as a factor variable

  • Batch effects:

    • Problem: Systematic variations between experimental batches

    • Solution: Use balanced designs with samples from different treatment groups in each batch; incorporate batch as a categorical variable in statistical models

  • Sample degradation:

    • Problem: Rapid protein degradation affecting detection

    • Solution: Process samples immediately; add protease inhibitors; maintain cold chain throughout processing

How can researchers effectively optimize Western blotting protocols for O3far1 detection in rat tissue samples?

Optimizing Western blotting for O3far1 detection requires careful attention to several protocol elements:

  • Sample preparation:

    • Homogenize tissues in RIPA buffer supplemented with phosphatase and protease inhibitors

    • Maintain samples at 4°C throughout processing

    • Determine protein concentration using Bradford assay

    • Load 30-50μg of protein per lane for optimal detection

  • Electrophoresis and transfer conditions:

    • Use 10% SDS-PAGE gels for optimal separation

    • Transfer to PVDF membranes at constant voltage (100V for 60 minutes) in cold transfer buffer

    • Verify transfer efficiency with reversible protein stains before blocking

  • Antibody selection and validation:

    • Test multiple antibodies targeting different epitopes of O3far1

    • Include positive controls (tissues with known high expression)

    • Include negative controls (tissues from knockout models if available)

    • Optimize primary antibody concentration (typically 1:500 to 1:2000 dilution)

    • Use secondary antibodies with minimal cross-reactivity to rat proteins

  • Signal detection optimization:

    • Consider enhanced chemiluminescence systems for improved sensitivity

    • Optimize exposure times based on signal strength

    • Use digital imaging systems that allow for quantitative analysis

  • Normalization approach:

    • Select appropriate housekeeping proteins based on tissue type and experimental conditions

    • Verify stability of housekeeping protein expression across experimental conditions

    • Calculate O3far1 expression relative to housekeeping proteins using densitometry

How might advanced genetic approaches enhance our understanding of O3far1 function in rat models?

Advanced genetic approaches offer promising avenues for deepening our understanding of O3far1 function:

  • CRISPR/Cas9-mediated strategies:

    • Generation of tissue-specific O3far1 knockout rat models

    • Introduction of point mutations to investigate specific signaling pathways

    • Creation of reporter systems for real-time monitoring of O3far1 activity

    • Development of models with humanized O3far1 for translational research

  • Transcriptomic approaches:

    • RNA-seq analysis of tissues from rats with varying O3far1 expression levels

    • Single-cell RNA sequencing to understand cell-type specific responses

    • Temporal transcriptomic profiling following omega-3 fatty acid administration

    • Integration of transcriptomic data with proteomic and metabolomic datasets

  • Epigenetic investigations:

    • Characterization of epigenetic modifications affecting O3far1 expression

    • Analysis of diet-induced epigenetic changes in O3far1 regulatory regions

    • Investigation of transgenerational epigenetic effects on O3far1 function

  • Systems biology integration:

    • Development of computational models that integrate O3far1 signaling with broader metabolic networks

    • Multi-omics approaches that capture comprehensive effects of O3far1 activation

    • Machine learning applications to identify patterns in complex datasets related to O3far1 function

What are emerging approaches for studying the interaction between O3far1 and other metabolic receptors in complex diseases?

Emerging approaches for investigating O3far1 interactions with other receptors include:

  • Proximity labeling techniques:

    • BioID or APEX2-based approaches to identify proteins in close proximity to O3far1

    • Analysis of receptor complex formation under different dietary conditions

    • Investigation of dynamic changes in the O3far1 interactome during inflammatory responses

  • Advanced imaging methodologies:

    • Super-resolution microscopy to visualize receptor co-localization

    • FRET/BRET techniques to measure direct receptor interactions

    • Live-cell imaging to track receptor trafficking following omega-3 fatty acid stimulation

  • Multi-receptor signaling analysis:

    • Simultaneous monitoring of multiple receptor pathways (e.g., O3far1 and PPARs)

    • Phosphoproteomic analysis to identify convergent signaling nodes

    • Development of dual-receptor targeting strategies for metabolic diseases

  • Translational research approaches:

    • Parallel studies in human and rat samples to validate conserved mechanisms

    • Development of biomarkers based on O3far1 activation status

    • Investigation of receptor polymorphisms and their impact on disease susceptibility and treatment response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.