Recombinant Rat Orexin receptor type 2 (Hcrtr2)

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Properties

Hcrtr2 activates G-protein signaling pathways (e.g., Gαq, Gαi/o, Gαs) and downstream effectors like:

  • Phospholipase C (PLC): Triggers intracellular calcium ([Ca²⁺]ᵢ) elevation via IP₃/DAG pathways .

  • ERK/Akt kinases: Orexin-B (OR-B) induces ERK1/2 and Akt phosphorylation in cardiac tissue, promoting cardioprotection .

  • Dimerization: Forms homodimers or heterodimers with other GPCRs (e.g., OX1R, CB1 receptors), modulating signaling diversity .

Ligand interactions:

  • Orexin A (OA): Binds with lower affinity compared to OX1R .

  • Orexin B (OB): Exhibits equal affinity to OX2R and OX1R, enabling broader physiological effects .

Research Applications

Recombinant Hcrtr2 is used to study:

Sleep Regulation

  • Narcolepsy models: OX2R knockouts in mice recapitulate narcolepsy-like sleep fragmentation. Restoring OX2R in the posterior hypothalamus rescues wakefulness but not sleep fragmentation .

  • Wake-promoting circuits: Directly activates tuberomammillary nucleus (TMN) neurons, enhancing alertness .

Cardiovascular Protection

  • Myocardial protection: OR-B/OX2R signaling increases cardiomyocyte contractility and reduces ischemia-reperfusion injury in rats. Human heart failure correlates with reduced OX2R expression .

Metabolic Regulation

  • Obesity resistance: Enhanced OX2R signaling in mice prevents high-fat diet-induced obesity, linking orexin signaling to energy balance .

Key Research Findings

StudyFindings
Myocardial protectionOR-B/OX2R increases ERK/Akt phosphorylation in rat and human hearts, reducing ischemic damage .
WakefulnessFocal OX2R restoration in TMN rescues wakefulness in narcoleptic mice .
Disease associationLow OX2R expression correlates with severe heart failure in humans .

Challenges and Future Directions

  • Species-specific roles: Rat Hcrtr2’s extracellular domains share 93% identity with mouse/rat, but intracellular signaling may diverge .

  • Therapeutic potential: Targeting OX2R for narcolepsy or heart failure requires balancing wake-promoting and cardioprotective effects .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Hcrtr2; Orexin receptor type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSSTKLEDSLPRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVS CIIMIPQAIVMERSSMLPGLANKTTLFTVCDERWGGEVYPKMYHICFFLVTYMAPLCLMV LAYLQIFRKLWCRQIPGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAEIKQIRARR KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN PIIYNFLSGKFREEFKAAFSCCLGVHRRQGDRLARGRTSTESRKSLTTQISNFDNVSKLS EHVALTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV
Uniprot No.

Target Background

Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References Into Functions
  1. Studies using specific orexin receptor antagonists suggest that the orexin 2 receptor plays a dominant role in the observed effects of orexin A/hypocretin-1. To our knowledge, this article is the first to demonstrate orexinergic modulation of the ventrolateral geniculate nucleus. PMID: 26724374
  2. The OX2 receptor plays a crucial role in modulating reward circuits within the Ventral Tegmental Area and Nucleus Accumbens. PMID: 26494513
  3. Activation of orexin perifornical hypothalamus-rostral ventrolateral medulla (RVLM) neurons and orexin type 2 receptors in the RVLM facilitates epinephrine release by increasing sympathetic drive to adrenal chromaffin cells during hypoglycemia. PMID: 26653571
  4. Orexin 2 receptors (along with orexin 1 receptors) contribute to the cardiovascular and locomotor response to stress. PMID: 25239810
  5. Orexins modify orexin receptor gene expression and gonadotropin release from the anterior pituitary gland. PMID: 24333629
  6. Elevated OX2R-mediated activity is observed in the brain. PMID: 23525245
  7. Evidence suggests a more prominent role for OX(2)R in ethanol self-administration compared to cue-conditioned ethanol-seeking. PMID: 23601187
  8. siRNA knockdown of OX2R in pontomesencephalic tegmentum increases the duration of REM episodes. PMID: 23282008
  9. OX2R protein and mRNA are expressed in C6 glioma cells. PMID: 22588980
  10. In cultured rat cortical neurons, acting at OX2 receptors coupled to Gi protein, orexin inhibits cyclic AMP synthesis. PMID: 21547533
  11. These findings demonstrate that orexins excite cerebellar IN neurons through OX(2)R and suggest that the central orexinergic nervous system actively participates in motor control by modulating the final outputs of the spinocerebellum. PMID: 19921532
  12. The role of hcrtR2 in nicotine's reinforcing effects is examined. PMID: 20177882
  13. In developing hypoglossal motoneurons dissociated from 4-to 33-day-old rats, the number of mRNA copies of the orexin type 2 receptor identified per cell is significantly higher around day 20 postnatally than at any other age. PMID: 11930155
  14. Orexin stimulation of amylase release by a pancreatic cell line is mediated by Orexin 2 receptors. PMID: 12409837
  15. Two distinct clusters of neurons containing orexin-B immunoreactivity within the amygdaloid complex may serve as a component of neuronal circuits involved in integrating complex homeostatic mechanisms associated with behaviors in the rat. PMID: 12650973
  16. Deterioration of the orexin system may contribute to age-related phenomena. PMID: 14749141
  17. Hypocretin, via the Hcrtr2 receptor, affects a specific subset of somatosensory cortex layer 6b neurons which, through corticocortical projections, may also be involved in promoting widespread cortical activation. PMID: 15282280
  18. Hypocretins play roles in driving drug seeking through activation of stress pathways in the brain. PMID: 16357203
  19. The Ox2R signaling pathway was studied in rat olfactory mucosa and olfactory afferent neurons. PMID: 17292491
  20. Data suggest that muscarinic-2 and orexin-2 receptors may define behavioral and state-regulating roles of GABA- and non-GABAergic neurons of the mesopontine reticular formation and lateral tegmentum, and their dysfunction in narcolepsy with cataplexy. PMID: 18709662
  21. These results support a dual role for oxB/hcrt-2 in mediating glutamatergic transmission in the VTA, and suggest that oxA/hcrt-1 and oxB/hcrt-2 exert distinct roles in enhancing the motivational components of arousal and feeding. PMID: 18793323
  22. Biochemical and behavioral characterization of EMPA, a novel high-affinity, selective antagonist for the OX(2) receptor. PMID: 19751316
  23. Orexin receptor expression was investigated in various tissues. OX2R exhibits sexually dimorphic expression in adrenal glands. PMID: 11459774

Show More

Hide All

Database Links

KEGG: rno:25605

STRING: 10116.ENSRNOP00000015824

UniGene: Rn.9893

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the brain in the cerebral cortex, septal nuclei, hippocampus, medial thalamic groups, dorsal and median raphe nuclei, and many hypothalamic nuclei including the tuberomammillary nucleus, dorsomedial hypothalamus, paraventricular hypothalamic

Q&A

What is the basic structure of rat Hcrtr2 compared to human HCRTR2?

Rat Hcrtr2, like its human counterpart, is a G-protein coupled receptor with seven transmembrane domains. The human HCRTR2 is a 444 amino acid protein with a molecular weight of approximately 40 kDa, functioning as a membrane-bound glycoprotein. Sequence alignment analyses reveal high conservation between species, with the extracellular portions of human HCRTR2 sharing 93% amino acid identity with corresponding portions of rat Hcrtr2 . This high degree of conservation suggests evolutionary importance in its function.

When working with recombinant rat Hcrtr2, researchers should note that despite this homology, species-specific differences may affect ligand binding affinity and downstream signaling cascades, potentially influencing experimental outcomes when translating findings between species models.

How does Hcrtr2 signaling differ from Hcrtr1 signaling at the molecular level?

Hcrtr2 and Hcrtr1 exhibit distinct signaling properties despite sharing approximately 64% sequence identity . Hcrtr2 demonstrates similar binding affinity for both orexin-A (hypocretin-1) and orexin-B (hypocretin-2) neuropeptides, whereas Hcrtr1 shows selective preference for orexin-A . At the G-protein coupling level, Hcrtr2 can activate multiple G protein subtypes including Gi, Gs, and Gq proteins as demonstrated in human adrenal cortex studies .

Studies utilizing receptor-specific antagonists and genetic knockdowns reveal that these receptors mediate distinct physiological responses. For instance, research has shown that Hcrtr2 plays a more prominent role in sleep-wake regulation, while Hcrtr1 may have greater involvement in reward processing . When designing experiments to isolate Hcrtr2-specific functions, researchers should employ selective antagonists such as NBI-80713 (NB-R2) which demonstrate high specificity for Hcrtr2 over Hcrtr1 .

What are the primary tissue expression patterns of recombinant rat Hcrtr2 in experimental models?

Recombinant rat Hcrtr2 expression patterns closely mirror endogenous expression, with predominant localization in the central nervous system. While Hcrtr2 is primarily expressed in the brain, particularly in histaminergic cells of the tuberomammillary nucleus , recent studies have expanded our understanding of its expression profile in reward and stress-related brain regions including the central nucleus of the amygdala (CeA) and nucleus accumbens (NAs) .

When establishing expression systems, researchers should consider that proper folding and post-translational modifications of recombinant Hcrtr2 are critical for maintaining physiological binding properties. Verification of expression patterns can be achieved through immunohistochemistry using antibodies targeting the prepro-HCRT peptide sequence, following established protocols that include appropriate tissue fixation with 4% formaldehyde, cryosectioning at 40 μm, and immunolabeling with validated antibodies such as rabbit anti-rat prepro-HCRT (AB3096, 1:1000) .

What are the optimal conditions for expressing functional recombinant rat Hcrtr2 in mammalian cell systems?

Achieving optimal expression of functional recombinant rat Hcrtr2 requires careful consideration of expression systems and conditions. Mammalian expression systems such as HEK293 or CHO cells typically yield better functional outcomes than bacterial or insect cell systems due to their capacity for appropriate post-translational modifications essential for GPCR functionality.

For transient transfection, a lipid-based transfection protocol using VersaClone cDNA constructs has shown good efficacy . The expression vector should contain strong promoters (CMV or EF1α) and appropriate selection markers. Critical parameters to optimize include:

  • Cell density: 70-80% confluence at transfection typically yields optimal results

  • DNA:transfection reagent ratio: Typically 1:3 works well, but requires optimization for each cell line

  • Incubation conditions: 37°C, 5% CO₂, 48-72 hours post-transfection before harvesting

  • Media supplements: Addition of sodium butyrate (5-10 mM) 24 hours post-transfection can enhance expression

Functionality assessment should include both binding assays with labeled orexin peptides and downstream signaling assays such as calcium mobilization or cAMP accumulation to confirm that the recombinant receptor couples appropriately to G-proteins .

How can researchers effectively validate knockdown efficiency in Hcrtr2 genetic manipulation studies?

Validating knockdown efficiency in Hcrtr2 genetic manipulation studies requires a multi-faceted approach to ensure both molecular and functional confirmation. Based on published methodologies, the following protocol is recommended:

For shRNA-mediated knockdown, as employed in recent studies using AAVretro-mediated delivery:

  • Molecular validation:

    • qRT-PCR analysis of Hcrtr2 mRNA levels in target tissues, normalizing to appropriate housekeeping genes

    • Western blot analysis of protein expression using validated antibodies

    • Immunohistochemistry in brain sections to visualize spatial reduction in Hcrtr2 expression

  • Functional validation:

    • Calcium mobilization assays in response to orexin-A/B stimulation

    • Electrophysiological recordings to assess changes in neuronal activity

    • Behavioral assessments (sleep-wake patterns, reward-seeking behaviors)

A particularly effective validation approach utilized in recent studies combines targeted shRNA delivery with immunohistochemical verification. Researchers have successfully employed a loop sequence (5'-AGTCGACA-3') with shRNA constructs targeting Hcrtr2 transcript (5'-GTCTTCTATCCCTGTCCTAGT-3'), packaged into retrogradely transported AAV2 serotype vectors (titer of 7.4×10^11 GU/mL) . Validation timepoints at 2, 4, and 6 weeks post-injection provide a comprehensive timeline of knockdown dynamics.

What are the critical considerations when designing ligand binding studies for rat Hcrtr2?

Designing rigorous ligand binding studies for rat Hcrtr2 requires careful attention to several methodological parameters:

  • Membrane preparation: For receptor binding studies, membrane fractions should be prepared from Hcrtr2-expressing cells or tissues using differential centrifugation in buffer containing protease inhibitors to prevent receptor degradation.

  • Ligand selection:

    • Radioligand studies: [¹²⁵I]-orexin-A or [¹²⁵I]-orexin-B (0.1-0.5 nM range)

    • Fluorescent ligands: TAMRA or Cy5-labeled orexin peptides for FRET/BRET applications

    • Competition ligands: Unlabeled orexin-A/B and selective antagonists (e.g., NBI-80713)

  • Binding conditions optimization:

    • Buffer composition: Typically 25 mM HEPES, 10 mM MgCl₂, 1 mM CaCl₂, pH 7.4

    • Temperature: 25°C for 60-90 minutes to reach equilibrium

    • Non-specific binding: Determined in presence of 1-10 μM unlabeled ligand

  • Data analysis:

    • For saturation binding: Scatchard analysis to determine K<sub>d</sub> and B<sub>max</sub>

    • For competition studies: IC₅₀ values converted to K<sub>i</sub> using the Cheng-Prusoff equation

    • Hill coefficients should be calculated to assess binding cooperativity

Researchers should note that Hcrtr2 has similar affinity for both orexin-A and orexin-B neuropeptides , unlike Hcrtr1 which displays preferential binding to orexin-A. This characteristic can be leveraged to distinguish between receptor subtypes in tissues expressing both receptors.

How can researchers effectively differentiate between Hcrtr1 and Hcrtr2 signaling in complex neuronal circuits?

Differentiating between Hcrtr1 and Hcrtr2 signaling in complex neuronal circuits requires sophisticated approaches that combine pharmacological, genetic, and electrophysiological techniques:

  • Receptor-selective pharmacology:

    • Utilize Hcrtr2-selective antagonists such as NBI-80713 (NB-R2) in parallel with Hcrtr1-selective antagonists like SB-408124 (SB-R1)

    • Compare effects with dual Hcrtr1/2 antagonists (e.g., NBI-87571) to identify receptor-specific contributions

    • Employ concentration-dependent effects to establish selectivity windows

  • Conditional genetic approaches:

    • Cell-type specific receptor knockouts using Cre-LoxP technology

    • Targeted shRNA-mediated knockdown with retrograde AAV delivery to specific neuronal populations

    • DREADD (Designer Receptors Exclusively Activated by Designer Drugs) technology to manipulate specific receptor-expressing neurons

  • Circuit-level analysis:

    • Implement optogenetic stimulation of orexin neurons while recording from Hcrtr1 vs. Hcrtr2 expressing target populations

    • Utilize fiber photometry to monitor calcium dynamics in defined neuronal populations following selective receptor modulation

    • Apply electrophysiological recordings with pharmacological isolation to determine receptor-specific electrophysiological signatures

Recent research has demonstrated that inactivation of Hcrtr2, but not Hcrtr1, in dopaminergic neurons produces distinctive electrophysiological signatures, including dramatic increases in theta (7-11 Hz) activity during both wakefulness and REM sleep . This approach of comparing phenotypes between selective receptor knockdowns provides a powerful strategy for dissecting receptor-specific contributions to complex neuronal circuit functions.

What are the methodological approaches for investigating Hcrtr2's role in sleep-wake regulation versus reward processing?

Investigating Hcrtr2's dual roles in sleep-wake regulation and reward processing requires carefully designed methodological approaches that can dissociate these distinct but interconnected functions:

  • Sleep-wake regulation studies:

    • Polysomnographic recordings (EEG/EMG) in Hcrtr2-manipulated animals to assess:

      • Sleep architecture (NREM/REM/wake distribution)

      • Sleep-wake transitions and fragmentation

      • EEG power spectrum analysis across vigilance states

    • Circadian considerations: Record across full light-dark cycles

    • Sleep deprivation challenges to assess homeostatic regulation

    • Analysis of specific EEG signatures including theta (7-11 Hz) and gamma (52-80 Hz) oscillations

  • Reward processing assessment:

    • Operant conditioning paradigms with progressive ratio schedules to assess motivation

    • Place preference conditioning to evaluate reward valuation

    • Assessment of impulsivity and compulsivity using:

      • Five-choice serial reaction time task

      • Go/No-Go paradigms

      • Delayed discounting tasks

    • Intracranial self-stimulation to evaluate brain reward thresholds

  • Integrated experimental designs:

    • Time-locked EEG/EMG recordings during reward tasks to correlate neural oscillations with reward-seeking behaviors

    • Region-specific manipulation of Hcrtr2 in reward circuits (VTA, NAc) versus sleep-regulatory regions (TMN, LC)

    • Molecular profiling (RNA-seq, proteomics) of brain regions following sleep deprivation versus reward exposure

Recent studies have revealed that DA-specific Hcrtr2-deficient mice show both enhanced EEG signatures of arousal and altered patterns of reward-seeking behavior, exhibiting faster task acquisition and higher choice accuracy but also increased impulsivity and compulsivity . This suggests a complex interaction between arousal and reward systems mediated by Hcrtr2 signaling.

How can researchers accurately quantify changes in Hcrtr2 expression in response to physiological or pathological conditions?

Accurately quantifying changes in Hcrtr2 expression requires a comprehensive approach combining molecular, cellular, and functional assessment techniques:

  • mRNA quantification:

    • qRT-PCR using validated primers specific to rat Hcrtr2

    • In situ hybridization to preserve spatial information

    • RNA-seq for genome-wide expression analysis and identification of co-regulated genes

    • Single-cell RNA-seq to identify cell-type specific expression changes

  • Protein quantification:

    • Western blotting with validated antibodies

    • ELISA assays for high-throughput screening

    • Immunohistochemistry protocols:

      • Tissue fixation: 4% formaldehyde, post-fixed overnight

      • Sectioning: 40 μm cryosections

      • Blocking: 10% normal goat serum

      • Primary antibody: rabbit anti-rat prepro-HCRT (1:1000)

      • Secondary detection: biotinylated goat anti-rabbit antibody (1:200)

      • Visualization: avidin-biotin complex with Vector SG substrate

  • Functional receptor assessment:

    • Radioligand binding assays to determine B<sub>max</sub> values

    • GTPγS binding assays to measure G-protein coupling efficiency

    • Calcium mobilization assays to assess signaling capacity

    • Electrophysiological recordings to measure neuronal responsiveness to orexin peptides

A standardized experimental design should include appropriate controls for circadian variation, as Hcrtr2 expression can fluctuate with circadian rhythms. Time-course analyses are essential when studying dynamic changes in expression, such as during disease progression or in response to treatments. For example, in studies of alcohol dependence, researchers have effectively examined Hcrtr1 and Hcrtr2 gene expression in the central amygdala and nucleus accumbens during withdrawal periods compared to non-dependent controls .

What are common pitfalls in Hcrtr2 functional assays and how can they be addressed?

Researchers frequently encounter several challenges when conducting Hcrtr2 functional assays. Here are the most common pitfalls and recommended solutions:

  • Receptor internalization and desensitization:

    • Problem: Repeated stimulation with orexin peptides can cause receptor internalization, leading to diminished responses over time.

    • Solution: Use pulsed application protocols with recovery periods, employ β-arrestin recruitment assays to quantify internalization, or include endocytosis inhibitors during acute functional studies.

  • G-protein promiscuity:

    • Problem: Hcrtr2 couples to multiple G-proteins (Gi, Gs, Gq) , making pathway-specific effects difficult to isolate.

    • Solution: Use pathway-selective inhibitors (e.g., PTX for Gi inhibition), employ BRET-based sensors to monitor specific G-protein activation, or utilize downstream pathway-specific readouts (e.g., IP3 for Gq, cAMP for Gs/Gi).

  • Poor signal-to-noise ratio:

    • Problem: Weak functional responses, particularly in primary neuronal cultures.

    • Solution: Optimize expression levels, use amplification systems like FLIPR for calcium assays, or implement more sensitive techniques such as electrophysiology for endogenous receptors.

  • Inconsistent results in behavioral assays:

    • Problem: High variability in behavioral outcomes following Hcrtr2 manipulation.

    • Solution: Increase sample sizes, control for circadian timing of experiments, validate knockdown/antagonist efficacy in each experimental cohort, and employ automated behavioral analysis to reduce observer bias.

  • Antibody specificity issues:

    • Problem: Poor specificity of commercial antibodies for Hcrtr2.

    • Solution: Validate antibodies using knockout/knockdown controls, employ epitope-tagged recombinant receptors when possible, or use orthogonal approaches like in situ hybridization to confirm expression patterns.

Researchers have successfully addressed these challenges by implementing comprehensive controls and validation steps. For example, studies examining the behavioral effects of Hcrtr2 antagonism have verified target engagement by measuring antagonist concentrations in cerebrospinal fluid and confirming receptor occupancy through ex vivo binding assays .

How can researchers address the challenge of distinguishing direct versus indirect effects of Hcrtr2 manipulation in vivo?

Distinguishing direct versus indirect effects of Hcrtr2 manipulation presents a significant challenge in neuroscience research. This challenge can be addressed through a multi-level experimental approach:

  • Temporal resolution strategies:

    • Implement optogenetic approaches for millisecond-precision control of orexin neurons

    • Utilize caged orexin peptides with photolysis for rapid, localized receptor activation

    • Compare immediate (seconds to minutes) versus delayed (hours to days) responses following receptor manipulation

  • Spatial resolution approaches:

    • Site-specific microinjection of Hcrtr2 antagonists or shRNA constructs

    • Cell type-specific genetic manipulation using Cre-driver lines (e.g., DAT-Cre for dopaminergic neurons)

    • Retrograde viral vectors to target specific neuronal projections:

      • AAVretro carrying Hcrtr2 shRNA constructs delivered to projection targets

      • Designer receptors to manipulate specific circuit elements

  • Molecular and signaling pathway dissection:

    • Pathway-selective G-protein interventions (e.g., DREADD receptors coupled to specific G-proteins)

    • Downstream effector inhibition to block specific signaling cascades

    • Transcriptional profiling (RNA-seq) following acute versus chronic receptor manipulation to identify primary versus secondary response genes

  • Parallel interventions across circuit components:

    • Simultaneous recording from multiple brain regions following Hcrtr2 manipulation

    • Sequential inhibition of interconnected brain regions to map information flow

    • Cross-circuit rescue experiments to determine necessity of downstream regions

A particularly effective approach employed in recent research utilized selective genetic inactivation of Hcrtr2 in dopaminergic neurons, which revealed specific effects on theta and gamma EEG activity that were not observed with Hcrtr1 inactivation in the same neuronal population . Such comparative approaches between receptor subtypes in defined cell populations provide powerful tools for isolating receptor-specific contributions to complex behaviors.

What methodological considerations are critical when translating findings from recombinant systems to endogenous Hcrtr2 in native tissues?

Translating findings from recombinant systems to endogenous Hcrtr2 function requires careful attention to several methodological considerations:

  • Expression level disparities:

    • Challenge: Recombinant systems typically overexpress receptors relative to physiological levels.

    • Approach: Quantify receptor density in both systems using radioligand binding (B<sub>max</sub> determination) and adjust data interpretation accordingly. Utilize inducible expression systems to achieve near-physiological receptor levels.

  • Signaling environment differences:

    • Challenge: Native tissues contain the full complement of signaling components that may be missing in recombinant systems.

    • Approach: Characterize G-protein subtype expression in target tissues and ensure recombinant cells express appropriate G-protein subtypes. Compare coupling efficiency using GTPγS binding assays in both systems.

  • Receptor modification differences:

    • Challenge: Post-translational modifications may differ between recombinant and native receptors.

    • Approach: Employ mass spectrometry to characterize receptor modifications in both systems. Consider using tissue-derived cell lines that may better recapitulate the native cellular environment.

  • Verification experiments in native systems:

    • Validate key findings using ex vivo tissue preparations

    • Develop and apply tissue-specific functional assays

    • Implement acute tissue slice electrophysiology with pharmacological interventions

  • In vivo confirmation strategies:

    • Design studies that examine dose-response relationships in vivo

    • Utilize biosensors to measure second messengers in specific cell types in vivo

    • Develop pharmacokinetic/pharmacodynamic models that account for differences between systems

A comprehensive approach to translation was demonstrated in studies examining the role of Hcrtr2 in alcohol dependence, where findings from recombinant receptor systems were validated through pharmacological interventions in rodent models, alongside gene expression analysis in relevant brain regions and targeted genetic manipulation of HCRT projections using retrograde AAV vectors . This multi-level verification approach provides the strongest evidence for translating mechanistic findings from recombinant systems to physiologically relevant contexts.

How can recent advances in cryo-EM technology be applied to study rat Hcrtr2 structure-function relationships?

Recent advances in cryo-electron microscopy (cryo-EM) technology offer unprecedented opportunities to study the structural biology of Hcrtr2 and its interactions with ligands and signaling partners:

  • Sample preparation optimization for Hcrtr2:

    • Expression in mammalian expression systems with proper post-translational modifications

    • Purification in lipid nanodiscs or detergent micelles to maintain native-like membrane environment

    • Stabilization strategies including:

      • Thermostabilizing mutations based on evolutionary conservation analysis

      • Complexation with high-affinity ligands (orexin peptides or synthetic antagonists)

      • Antibody fragment (Fab) or nanobody co-purification to stabilize specific conformations

  • Cryo-EM workflow for Hcrtr2 structural studies:

    • Grid preparation with optimized blotting conditions for membrane proteins

    • Data collection parameters:

      • 300kV electron microscopes with direct electron detectors

      • Movie mode acquisition (40-50 frames) with motion correction

      • Defocus range of -0.8 to -2.5 μm for optimal contrast

    • Image processing:

      • 2D classification to identify homogeneous populations

      • 3D classification to separate conformational states

      • Refinement to achieve resolution better than 3.5Å for side-chain visualization

  • Structure-function applications:

    • Mapping of ligand binding sites through:

      • Comparison of apo versus bound states

      • Mutagenesis of predicted binding site residues with functional validation

    • Elucidation of G-protein coupling interfaces to understand:

      • Structural basis for G-protein promiscuity of Hcrtr2

      • Conformational changes associated with activation

    • Comparison with Hcrtr1 structures to identify receptor subtype-specific structural features

  • Integration with computational approaches:

    • Molecular dynamics simulations using cryo-EM structures as starting models

    • Virtual screening of compound libraries against identified binding pockets

    • Structure-based design of novel selective ligands

The application of these approaches would significantly advance our understanding of how the 7-transmembrane structure of Hcrtr2 mediates its function as a receptor for both orexin-A and orexin-B neuropeptides and could reveal the structural basis for its unique signaling properties compared to Hcrtr1.

What are the cutting-edge approaches for studying Hcrtr2 dynamics in real-time in live neurons?

Recent technological advances have enabled sophisticated approaches for monitoring Hcrtr2 receptor dynamics in real-time within living neurons:

  • Genetically encoded biosensors:

    • FRET/BRET-based conformational sensors:

      • Insert fluorescent/luminescent protein pairs into intracellular loops and C-terminus

      • Monitor conformational changes upon ligand binding and during signaling

    • G-protein activation sensors:

      • Downward DAGGER sensors for simultaneous monitoring of multiple G-protein subtypes

      • Mini-G protein-based sensors to detect receptor-G protein coupling events

    • β-arrestin recruitment sensors to monitor receptor desensitization and internalization

  • Advanced microscopy techniques:

    • Single-molecule tracking to monitor:

      • Lateral diffusion of individual Hcrtr2 receptors

      • Clustering dynamics in response to orexin stimulation

      • Internalization and recycling kinetics

    • Super-resolution microscopy approaches:

      • STORM/PALM imaging to visualize nanoscale organization of Hcrtr2

      • Lattice light-sheet microscopy for 3D dynamics with reduced phototoxicity

    • Two-photon fluorescence lifetime imaging (FLIM) for quantitative FRET measurements in deep brain tissue

  • In vivo monitoring approaches:

    • Fiber photometry to record bulk calcium or cAMP signals in Hcrtr2-expressing neurons

    • Miniaturized microscopes (miniscopes) for cellular resolution imaging in freely moving animals

    • Genetically encoded voltage indicators to correlate Hcrtr2 activation with neuronal activity

  • Temporal control techniques:

    • Optogenetic manipulation of orexin neurons combined with Hcrtr2 activity sensors

    • Photoswitchable orexin ligands for precise spatiotemporal control of receptor activation

    • Chemogenetic approaches for sustained modulation of orexin release

These approaches can be particularly valuable for understanding how Hcrtr2 activation mediates its effects on vigilance states and reward processing. For example, researchers could employ these techniques to determine how Hcrtr2 activation in dopaminergic neurons contributes to the observed effects on theta and gamma oscillations and to directly visualize the dynamics of receptor activation during transitions between sleep and wakefulness.

How can researchers effectively implement CRISPR-Cas9 genome editing to study Hcrtr2 function in rat models?

Implementing CRISPR-Cas9 genome editing for studying Hcrtr2 function in rat models requires careful consideration of design, delivery, and validation strategies:

  • Target design and optimization:

    • gRNA design considerations:

      • Select target sites with minimal off-target potential using validated prediction algorithms

      • Design multiple gRNAs targeting different exons of the Hcrtr2 gene

      • For point mutations, design repair templates with silent mutations that disrupt the PAM site to prevent re-cutting

    • Recommended modifications:

      • Complete knockout: Target early exons to ensure loss of function

      • Conditional knockout: Insert loxP sites flanking critical exons

      • Reporter knock-in: Insert fluorescent protein sequences in-frame with Hcrtr2

  • Delivery methods for rat models:

    • Embryo manipulation:

      • Microinjection of CRISPR components into zygotes

      • Electroporation of rat embryos

    • Adult rat applications:

      • AAV-delivered CRISPR systems for region-specific editing

      • Non-viral delivery using lipid nanoparticles for reduced immunogenicity

  • Validation strategy:

    • Genomic validation:

      • PCR amplification and Sanger sequencing of the target region

      • Next-generation sequencing to detect mosaicism and quantify modification rates

      • Off-target analysis using whole-genome sequencing or targeted amplicon sequencing

    • Functional validation:

      • RT-qPCR to verify mRNA expression changes

      • Western blotting and immunohistochemistry to confirm protein alterations

      • Electrophysiological and behavioral assessments to confirm functional consequences

  • Experimental applications:

    • Generate rat models with humanized Hcrtr2 to improve translational relevance

    • Create reporter lines expressing fluorescent proteins under Hcrtr2 promoter control

    • Develop conditional knockout models to study cell type-specific Hcrtr2 functions

This approach would enable more sophisticated investigations of Hcrtr2 function than traditional knockout methods, allowing researchers to study receptor function in specific neuronal populations at defined developmental stages. For example, researchers could generate rat models with selective Hcrtr2 inactivation in dopaminergic neurons to further investigate the findings from mouse models showing altered EEG patterns and behavioral phenotypes .

What statistical approaches are most appropriate for analyzing complex behavioral data following Hcrtr2 manipulation?

Analyzing complex behavioral data following Hcrtr2 manipulation requires sophisticated statistical approaches that can capture multidimensional aspects of behavior while accounting for potential confounding variables:

  • Appropriate study design considerations:

    • Power analysis to determine sample size requirements based on expected effect sizes

    • Balanced experimental designs with appropriate control groups:

      • Wild-type controls

      • Scrambled shRNA controls when using RNAi approaches

      • Vehicle controls for pharmacological interventions

    • Repeated measures designs to reduce inter-subject variability

    • Latin square designs for crossover pharmacological studies

  • Recommended statistical approaches:

    • For continuous behavioral measures:

      • Mixed-effects models to account for repeated measures and random effects

      • ANCOVA to control for covariates such as baseline activity or body weight

      • Non-parametric alternatives when normality assumptions are violated

    • For categorical or event-based data:

      • Survival analysis for latency measures

      • Generalized linear mixed models with appropriate distributions (Poisson for count data)

      • Chi-square or Fisher's exact tests for categorical outcomes

  • Advanced analytical methods:

    • Multivariate approaches:

      • Principal component analysis to identify major behavioral dimensions

      • Discriminant analysis to classify behavioral states

      • Multidimensional scaling to visualize behavioral relationships

    • Time series analysis:

      • Autocorrelation analysis for repetitive behaviors

      • Change-point detection to identify behavioral state transitions

      • Cross-correlation with physiological measures (e.g., EEG power)

    • Machine learning approaches:

      • Support vector machines or random forests for behavioral classification

      • Hidden Markov models to identify behavioral states and transitions

      • Deep learning for automated behavioral annotation from video data

  • Interpretation frameworks:

    • Effect size reporting alongside p-values

    • Confidence intervals to indicate precision of estimates

    • Multiple comparison corrections appropriate to experimental questions

    • Transparent reporting of outlier handling and exclusion criteria

These approaches have been applied effectively in studies examining the behavioral consequences of Hcrtr2 manipulation, such as research demonstrating that DA-specific Hcrtr2-deficient mice exhibit both enhanced cognitive performance and maladaptive patterns of reward-seeking behavior .

How can researchers integrate electrophysiological and molecular data to develop comprehensive models of Hcrtr2 function?

Integrating electrophysiological and molecular data provides a powerful approach for developing comprehensive models of Hcrtr2 function across multiple levels of biological organization:

  • Data collection strategies:

    • Parallel sampling approaches:

      • Record electrophysiological data followed by molecular analysis of the same tissue

      • Utilize reporter systems to identify recorded neurons for subsequent single-cell molecular analysis

      • Implement slice electrophysiology with pharmacological manipulations followed by RNA-seq

    • Temporal alignment considerations:

      • Design experiments with consistent time points across methodologies

      • Account for circadian influences on both electrophysiological and molecular measures

      • Capture both acute and chronic adaptations to Hcrtr2 manipulation

  • Integration methodologies:

    • Correlation analyses:

      • Relate receptor expression levels to electrophysiological parameters

      • Correlate downstream signaling molecule expression with functional outcomes

      • Link transcript levels of ion channels to specific electrophysiological properties

    • Causal testing:

      • Identify candidate molecules from correlation analyses

      • Test functional consequences through targeted manipulation

      • Verify molecular mechanisms through pharmacological rescue experiments

  • Computational modeling approaches:

    • Multi-scale modeling frameworks:

      • Molecular dynamics simulations of Hcrtr2-ligand interactions

      • Intracellular signaling cascade models

      • Single neuron models incorporating identified ion channel changes

      • Neural network models capturing circuit-level adaptations

    • Model validation:

      • Test predictions with new experimental data

      • Refine models based on experimental outcomes

      • Identify key parameters through sensitivity analysis

  • Data visualization and analysis tools:

    • Dimension reduction techniques to visualize relationships between molecular and electrophysiological parameters

    • Network analysis to identify functional modules connecting molecular and electrophysiological changes

    • Pathway enrichment analysis to contextualize findings within biological functions

This integrative approach has proven valuable in recent research demonstrating that loss of Hcrtr2 in dopaminergic neurons induces a dramatic increase in theta (7-11 Hz) EEG activity along with enhanced theta-gamma phase-amplitude coupling . By connecting these electrophysiological changes to molecular mechanisms, researchers can develop comprehensive models explaining how Hcrtr2 regulates neuronal excitability and network oscillations.

What are the best practices for resolving contradictory results in Hcrtr2 research literature?

Resolving contradictory results in Hcrtr2 research literature requires a systematic approach to identify sources of variability and reconcile apparently conflicting findings:

  • Systematic evaluation of methodological differences:

    • Experimental model considerations:

      • Species differences (rat vs. mouse vs. human)

      • Strain variations within species

      • Age and sex of experimental subjects

      • Environmental conditions (housing, light cycle, stress levels)

    • Technical approach differences:

      • Global vs. conditional/regional Hcrtr2 manipulation

      • Acute vs. chronic interventions

      • Pharmacological vs. genetic approaches

      • Dose/concentration variations in pharmacological studies

  • Standardized reporting and meta-analysis:

    • Develop standardized reporting formats for:

      • Detailed methodological parameters

      • Raw data sharing

      • Effect size reporting with confidence intervals

    • Conduct systematic reviews and meta-analyses to:

      • Quantify effect sizes across studies

      • Identify moderating variables

      • Assess publication bias

  • Replication and extension strategies:

    • Direct replication attempts with:

      • Pre-registered protocols

      • Sample sizes based on power analyses

      • Blinded assessment of outcomes

    • Triangulation approaches:

      • Test the same hypothesis using different methodologies

      • Combine in vitro, ex vivo, and in vivo approaches

      • Cross-validate findings across different laboratories

  • Contextual interpretation framework:

    • Consider biological context:

      • Circadian timing of experiments

      • Physiological state (fed vs. fasted)

      • Stress level prior to and during experiments

    • Embrace complexity:

      • Develop models that can account for bidirectional or context-dependent effects

      • Consider receptor dynamics and temporal aspects of signaling

      • Account for compensatory mechanisms in chronic studies

As demonstrated in the research literature, seemingly contradictory findings regarding Hcrtr2 function can often be reconciled by careful consideration of experimental context. For example, the observation that Hcrtr2 inactivation in dopaminergic neurons produces seemingly paradoxical effects—both increased EEG signatures of arousal and altered reward-seeking behaviors —highlights the complex and context-dependent nature of Hcrtr2 signaling across different neural circuits and behavioral states.

How do findings from rat Hcrtr2 studies translate to human clinical applications for sleep disorders?

Translating findings from rat Hcrtr2 studies to human clinical applications requires careful consideration of species similarities and differences, with particular attention to the role of Hcrtr2 in sleep regulation:

  • Comparative biology considerations:

    • Receptor conservation analysis:

      • Human HCRTR2 shares high sequence homology with rat Hcrtr2, with the extracellular portions showing 93% amino acid identity

      • Similar pharmacological profiles with respect to orexin peptide binding

      • Conserved G-protein coupling preferences across species

    • Neural circuit differences:

      • Similar distribution in sleep-wake regulatory centers

      • Species differences in receptor density in specific brain regions

      • Potential differences in receptor reserve and signal amplification

  • Translational research pathway:

    • Preclinical to clinical progression:

      • Validation in multiple rodent models before human studies

      • Receptor occupancy studies using PET ligands to establish dose-response relationships

      • Translational biomarkers (e.g., EEG signatures) that work across species

    • Human genetic evidence:

      • HCRTR2 mutations associated with narcolepsy in humans

      • Correlation between receptor polymorphisms and sleep phenotypes

      • Human genetic data to validate targets identified in rodent models

  • Clinical application domains:

    • Primary sleep disorders:

      • Narcolepsy treatments targeting HCRTR2

      • Insomnia therapies using HCRTR2 antagonists

      • Circadian rhythm sleep disorders

    • Secondary sleep disturbances:

      • Sleep fragmentation in neurodegenerative disorders

      • Substance use disorder-related sleep disruption

      • Stress and anxiety-induced insomnia

  • Optimizing translation success:

    • Target engagement biomarkers:

      • CSF orexin levels as diagnostic and response markers

      • EEG signatures (e.g., theta oscillations) as functional readouts

      • Sleep architecture parameters as clinically relevant endpoints

    • Accounting for human heterogeneity:

      • Stratification based on genetic factors

      • Personalized approaches based on circadian phenotypes

      • Consideration of comorbidities affecting sleep regulation

Studies demonstrating that HCRTR2-deficient animals exhibit phenotypes remarkably similar to human narcolepsy provide strong translational validity for this research. The importance of HCRTR2 in sleep-wake regulation is further supported by the finding that selective manipulation of this receptor in specific neuronal populations produces distinct effects on EEG oscillations and sleep architecture .

What considerations are critical when designing preclinical studies of Hcrtr2 antagonists for potential therapeutic applications?

Designing rigorous preclinical studies of Hcrtr2 antagonists requires careful consideration of pharmacological, physiological, and methodological factors to maximize translational potential:

  • Compound characterization and selection:

    • Pharmacological profile assessment:

      • Selectivity for Hcrtr2 over Hcrtr1 (e.g., NBI-80713)

      • Binding affinity (K<sub>i</sub> values)

      • Functional antagonism potency (IC<sub>50</sub> values)

      • Off-target screening against related GPCRs and other potential targets

    • Pharmacokinetic evaluation:

      • Brain penetration and blood-brain barrier permeability

      • Plasma and CSF half-life

      • Metabolism and potential active metabolites

      • Protein binding characteristics

  • Dosing regimen optimization:

    • Dose-response relationships:

      • Establish full dose-response curves

      • Determine minimum effective doses

      • Assess safety margins between effective and toxic doses

    • Temporal considerations:

      • Duration of receptor occupancy

      • Optimal timing relative to circadian phase

      • Acute versus chronic administration effects

      • Potential tolerance/sensitization with repeated dosing

  • Outcome measure selection:

    • Target engagement biomarkers:

      • Ex vivo receptor occupancy

      • Functional antagonism of orexin-induced responses

    • Efficacy endpoints:

      • Sleep architecture parameters (EEG/EMG polysomnography)

      • EEG spectral analysis focusing on theta (7-11 Hz) and gamma (52-80 Hz) bands

      • Behavioral assessments aligned with clinical endpoints

    • Safety and tolerability measures:

      • Cardiovascular parameters

      • Metabolic effects

      • Cognitive and motor performance

  • Experimental design considerations:

    • Use of relevant disease models:

      • Models of insomnia or sleep disruption

      • Comorbidity models (e.g., anxiety with sleep disruption)

      • Aged animals to reflect elderly patient populations

    • Control conditions:

      • Vehicle controls

      • Positive controls with established sleep-promoting agents

      • Comparison with dual Hcrtr1/2 antagonists to assess receptor selectivity benefits

The approach of testing selective HCRTR2 antagonists like NBI-80713 alongside dual HCRTR1/2 antagonists like NBI-87571 provides valuable comparative data to determine receptor subtype-specific effects, which is essential for optimizing therapeutic targeting for specific sleep disorders or comorbid conditions.

How can researchers effectively model Hcrtr2-associated pathologies in rats to maximize translational relevance?

Developing translationally relevant rat models of Hcrtr2-associated pathologies requires careful design choices to recapitulate key aspects of human disorders:

  • Narcolepsy/cataplexy models:

    • Genetic approaches:

      • CRISPR-Cas9 targeted disruption of Hcrtr2

      • Conditional knockout in specific cell populations

      • Knock-in of human disease-associated HCRTR2 mutations

    • Validation criteria:

      • Fragmented sleep-wake patterns

      • Cataplexy-like behavioral arrests

      • Abnormal REM sleep intrusions during wakefulness

      • EEG signatures characteristic of human narcolepsy

    • Translational assessment:

      • Response to treatments used in human narcolepsy

      • Progression of symptoms over time

      • Sex differences in symptom presentation

  • Addiction and reward dysregulation models:

    • Experimental paradigms:

      • Self-administration of drugs of abuse with progressive ratio schedules

      • Two-bottle choice for alcohol consumption

      • Conditioned place preference with dose-response assessment

    • Circuit-specific manipulations:

      • Targeted disruption of Hcrtr2 in dopaminergic neurons

      • Manipulation of Hcrtr2 in specific reward circuit nodes

      • Combined EEG/EMG recording during drug-seeking behavior

    • Validation against human addiction criteria:

      • Escalation of intake

      • Resistance to punishment

      • Relapse vulnerability

      • Compulsive seeking despite negative consequences

  • Stress-related disorder models:

    • Stress induction protocols:

      • Chronic unpredictable mild stress

      • Social defeat stress

      • Early life stress paradigms

    • Measurement of Hcrtr2-specific outcomes:

      • Stress-induced changes in sleep architecture

      • Alterations in reward sensitivity

      • Changes in Hcrtr2 expression in stress-responsive brain regions

    • Therapeutic testing:

      • Response to selective Hcrtr2 antagonists

      • Combined treatment approaches targeting stress and sleep systems

  • Comorbidity modeling:

    • Integration of multiple phenotypes:

      • Sleep disruption with anxiety-like behavior

      • Metabolic dysregulation with sleep abnormalities

      • Pain sensitivity with altered sleep-wake cycles

    • Longitudinal assessment:

      • Developmental trajectory of symptoms

      • Interaction between pathologies over time

      • Sequence of symptom emergence

These approaches have been successfully applied in recent research, such as studies using chronic intermittent exposure to alcohol vapor to create dependence models, followed by examination of Hcrtr1 and Hcrtr2 gene expression in reward/stress-related brain regions and testing of selective receptor antagonists . Such models provide valuable platforms for investigating disease mechanisms and evaluating potential therapeutic interventions targeting the Hcrtr2 system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.