Recombinant Rat Outer dense fiber protein 4 (Odf4)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Overview

Recombinant Rat Odf4 is a synthesized version of the protein encoded by the Odf4 gene, localized in the outer dense fibers (ODFs) of sperm tails. These fibers provide structural support and stabilize the axoneme during motility . Odf4 belongs to the cancer-testis antigen family, with restricted expression in normal tissues but aberrant expression in certain cancers .

PropertyDescription
Gene IDRat: 303236
Chromosomal LocationRat: Chromosome 10 ; Human: 17p13.1
Molecular Weight~30 kDa (human ortholog)
Primary FunctionStructural stabilization of sperm tail axoneme; potential immunotherapeutic target in cancers

Gene Structure

The Odf4 gene in rats spans ~6,200 bp on chromosome 10, with three exons encoding a protein of approximately 300 amino acids . Alternative splicing may generate multiple transcript variants, though specific isoforms for rat Odf4 are not explicitly detailed in available literature .

Protein Features

  • Localization: Exclusively expressed in testis under normal conditions, with expression in mature sperm flagella .

  • Interactions: Binds acetylated α-tubulin to stabilize axoneme structure, as demonstrated in human and rodent models .

Role in Sperm Motility

ODF4 is critical for sperm tail mechanics. Defects in ODF4 expression correlate with asthenozoospermia (reduced motility), as shown in human studies .

ParameterControl (Fertile)AsthenozoospermicCorrelation
ODF4 Expression (WB)High↓↓Direct link to motility
Axoneme DefectsLowHighPositive correlation
Non-Motile Sperm (%)<5%>40%Significant association

Key Insight: ODF4 hypoexpression reduces acetylated α-tubulin levels, destabilizing axoneme integrity .

Cancer-Testis Antigen (CTA) Properties

ODF4 exhibits CTA characteristics, with restricted normal tissue expression but activation in malignancies:

Cancer TypeODF4 ExpressionMechanismReference
Chronic Myeloid Leukemia (CML)30% of casesHypomethylation-driven activation
Prostate AdenocarcinomaNot detectedTissue-specific silencing

Therapeutic Potential: ODF4’s restricted expression makes it a candidate for targeted immunotherapy or biomarker development .

Recombinant Production and Experimental Use

While specific protocols for recombinant rat Odf4 are not detailed in available literature, general methods for ODF proteins include:

  1. Host Systems: E. coli (for soluble expression) or mammalian cells (for post-translational modifications) .

  2. Applications:

    • Structural Studies: Co-crystallization with axoneme components to map interaction sites .

    • Functional Assays: Testing ODF4’s role in shear-force resistance of sperm models .

Comparative Insights Across Species

ODF4 homologs share conserved functions but differ in expression patterns:

SpeciesGene IDKey FindingsReference
Human146852Expressed in sperm flagella; linked to CML
Rat303236Hypoexpression correlates with motility defects
Mouse252868Conditional knockout models mimic human asthenozoospermia

Future Research Directions

  • Therapeutic Targets: Epigenetic modulation (e.g., lithium) to upregulate ODF4 in asthenozoospermia .

  • Diagnostic Biomarkers: ODF4 expression profiling in cancer subtypes beyond CML .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have specific requirements for the format, please specify them in your order notes. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
Odf4; Outer dense fiber protein 4; Outer dense fiber of sperm tails protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Odf4
Target Protein Sequence
MESDLTVEESETIKTRSRRPLTEHRRHSLLPLQWKLAHSSRWMAQVVASEFSLLAFLLLL LMVFSKKWLYPSKSRFHQRYPQNITKRVYTSIHSMSTGLLYICISKSCLSSDNEEDNFKM WTIHPAFGVAKISFILAVGLGFVLTVWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLT LLLFPVNLWIYELKKNISVPIGWSYFIGWLVLILYLTCGILCYLNHKNFWSLIMSSSSIN ATCSSSVPVSLMNTSQISKSQADILDPTQDDQKPLSSDNIALPPNPDTTD
Uniprot No.

Target Background

Function
Outer dense fiber protein 4 (Odf4) is a component of the outer dense fibers (ODF) of spermatozoa. It is believed to play a role in sperm tail structure, sperm movement, and the overall organization of the cellular cytoskeleton.
Database Links

KEGG: rno:303236

UniGene: Rn.137152

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are outer dense fibers and what is their significance in sperm physiology?

Outer dense fibers (ODFs) are cytoskeletal structures unique to the sperm tail. While their definitive function has not been fully established, current evidence suggests they play critical roles in sperm motility and provide elastic recoil properties essential for proper flagellar movement . ODFs are present in both the sperm tail midpiece (alongside the mitochondrial sheath) and the principal piece . These fibers provide structural support and may contribute to the mechanical properties required for successful fertilization. Understanding ODF proteins, including Odf4, is crucial for comprehensive investigation of male fertility mechanisms and reproductive biology .

How does Odf4 differ from other characterized ODF proteins?

Odf4, also known as Outer dense fiber of sperm tails protein 4, is one of several protein components of the outer dense fibers. While Odf1 and Odf2 were among the first ODF proteins to be cloned and characterized, Odf4 represents a distinct member of this protein family . Unlike Odf1 (27-kDa) which localizes exclusively to the medulla of the fibers, and Odf2 (84-kDa) which is present in both the cortex and medulla, Odf4 has its own unique structural properties and localization pattern . Additionally, interaction studies have shown that proteins like Odf1 and Spag4 interact through leucine zipper motifs, while Odf4 may have different binding partners and interaction mechanisms .

What are the optimal storage conditions for recombinant Rat Odf4?

For recombinant Rat Odf4, optimal storage conditions are critical to maintain protein stability and activity. The protein should be stored in a Tris-based buffer containing 50% glycerol that has been optimized specifically for Odf4 stability . For short-term storage (up to one week), working aliquots can be maintained at 4°C. For longer-term storage, the protein should be kept at -20°C, while extended storage periods require conservation at -20°C or -80°C .

To minimize protein degradation, it is important to avoid repeated freeze-thaw cycles, as this can significantly compromise protein integrity and experimental reproducibility . Researchers should prepare appropriately sized aliquots based on experimental needs to prevent unnecessary thawing and refreezing of the stock solution.

How can one verify the expression and localization of Odf4 in experimental samples?

Verification of Odf4 expression and localization in experimental samples can be accomplished through multiple complementary approaches:

  • RT-PCR Analysis: For RNA expression, design primers specific to Odf4 mRNA. This approach has been successfully used for other ODF proteins and can be adapted for Odf4 . For example, RT-PCR with exon-specific primers can detect expression patterns in different tissues or developmental stages.

  • Northern Blot Analysis: This technique can confirm the size and abundance of Odf4 mRNA transcripts. Northern blotting has been effectively used to detect expression of ODF-related mRNAs, revealing specific transcript sizes (e.g., ~2.8 kb for some ODF-related transcripts) .

  • Western Blot Analysis: Using Odf4-specific antibodies, western blotting can confirm protein expression and molecular weight. Cross-reactivity testing is important, as some ODF proteins have been shown to immunocrossreact with each other .

  • Immunolocalization: Immunofluorescence or immunogold electron microscopy using specific antibodies can determine the precise subcellular localization of Odf4 within sperm tail structures. This approach has revealed that different ODF proteins localize to specific regions of the fibers .

What experimental approaches can be used to study Odf4 interactions with other sperm tail proteins?

Several experimental approaches are effective for studying protein-protein interactions involving Odf4:

  • Yeast Two-Hybrid System: This method has successfully identified interactions between other ODF proteins (e.g., Spag5 was identified as interacting with Odf1) . This approach can be applied to identify novel Odf4 binding partners.

  • Co-immunoprecipitation: Using antibodies against Odf4 to precipitate protein complexes from sperm or testicular lysates, followed by mass spectrometry or western blotting to identify interacting partners.

  • Leucine Zipper Analysis: Since several ODF proteins interact through leucine zipper motifs, computational analysis followed by mutational studies of potential leucine zipper regions in Odf4 can reveal interaction mechanisms .

  • Pull-down Assays: Using recombinant Odf4 as bait to capture interacting proteins from testicular or sperm lysates.

  • Surface Plasmon Resonance: For quantitative measurement of binding affinities between Odf4 and candidate interacting proteins.

These approaches can be complemented by genetic studies, such as gene trapping or knockout models, to understand the functional significance of Odf4 interactions in vivo .

What is known about the temporal expression pattern of Odf4 during spermatogenesis?

  • Odf1 and Spag4 are transcribed in round spermatids but translated later in elongating spermatids, indicating translational control mechanisms .

  • Odf2 transcription begins as early as pachytene spermatocytes and continues in round spermatids, with translation occurring in elongating spermatids .

Given the structural and functional similarities between ODF proteins, Odf4 may follow a similar pattern of developmental regulation. Research focusing specifically on Odf4 expression timing would be valuable for understanding its role in sperm tail development and function.

How does Odf4 contribute to sperm tail formation and function?

  • Structural Integrity: As part of the ODFs, Odf4 likely contributes to the cytoskeletal framework that provides structural support to the sperm tail .

  • Motility Regulation: ODFs are believed to play a role in sperm motility, potentially through modulating flagellar bending characteristics. Odf4 may contribute to this function .

  • Elastic Recoil Properties: ODFs provide elastic recoil to the sperm tail, and Odf4 may be involved in establishing or maintaining these mechanical properties .

  • Protein Scaffold: Like other ODF proteins, Odf4 may serve as a scaffold for additional proteins involved in sperm tail function .

Further research using techniques such as gene targeting or site-directed mutagenesis would be valuable for elucidating the specific functions of Odf4 in sperm tail formation and function.

What post-translational modifications are important for Odf4 function?

  • Disulfide Bond Formation: Many ODF proteins are rich in cysteine residues that form disulfide bonds, contributing to the structural stability of the fibers.

  • Phosphorylation: Regulatory phosphorylation events may control protein-protein interactions or structural arrangements.

  • Glycosylation: Potential glycosylation could affect protein folding or interaction capabilities.

For comprehensive characterization of Odf4 post-translational modifications, methodologies such as mass spectrometry, site-directed mutagenesis of potential modification sites, and specific antibodies against modified forms would be valuable approaches.

How does Odf4 structurally and functionally compare to Odf1 and Odf2?

Comparing Odf4 with the better-characterized Odf1 and Odf2 proteins reveals several important distinctions:

FeatureOdf1Odf2Odf4
Molecular Weight27-kDa84-kDaFull-length protein (290 amino acids)
LocalizationExclusively in medulla of ODFsBoth cortex and medulla of ODFsNot specifically determined in search results
Interaction PartnersInteracts with Odf2 and Spag4 through leucine zipperInteracts with Odf1 through leucine zipperSpecific interactions not detailed in search results
Expression PatternTranscribed in round spermatids, translated in elongating spermatidsTranscribed from pachytene spermatocytes through round spermatids, translated in elongating spermatidsNot specifically detailed in search results

Odf1 and Odf2 have been characterized as major structural components of the ODFs, with their interaction mediated by leucine zipper motifs . The functional relationship between these established ODF proteins and Odf4 requires further investigation to determine whether Odf4 complements or provides distinct functions within the ODF structure .

What is the relationship between Odf4 and other accessory proteins like Spag4?

  • Spag4 interacts specifically with Odf1 (but not with Odf2) through leucine zipper motifs .

  • Spag4 is spermatid-specific and may serve as a link between ODFs and the axoneme, potentially aiding in Odf1 localization to the medulla of the ODF .

  • Spag4 protein localizes to microtubule-containing spermatid structures, including the transient manchette and the axoneme in elongating spermatids and epididymal sperm .

To determine the specific relationship between Odf4 and Spag4 or other accessory proteins, interaction studies including co-immunoprecipitation, yeast two-hybrid screening, or in vitro binding assays would be necessary. Understanding these relationships could provide insights into the assembly and function of the complex sperm tail structure.

How conserved is Odf4 across different mammalian species?

The search results don't specifically address the evolutionary conservation of Odf4 across mammalian species. A comprehensive analysis would require:

  • Sequence Alignment: Comparing Odf4 sequences from different mammals to determine conservation at the amino acid level.

  • Domain Analysis: Identifying which functional domains or motifs are most conserved, suggesting their evolutionary importance.

  • Phylogenetic Analysis: Constructing evolutionary trees to understand the relationships between Odf4 proteins across species.

  • Expression Pattern Comparison: Determining whether the temporal and spatial expression patterns of Odf4 are conserved across species.

This type of comparative analysis would provide insights into the evolutionary significance of Odf4 and help identify functionally critical regions of the protein that have been maintained through evolutionary pressure.

What are the implications of Odf4 mutations or abnormal expression for sperm function and male fertility?

While the search results don't directly address Odf4 mutations, studies of other ODF proteins provide insight into potential implications:

Research using gene trap mutations of Odf2 has shown that disruption of ODF proteins can have significant consequences for sperm function . The implications of Odf4 mutations or abnormal expression might include:

  • Structural Abnormalities: Defects in sperm tail formation or stability, potentially resulting in abnormal morphology.

  • Motility Defects: Impaired sperm movement or swimming patterns due to compromised structural integrity or altered mechanical properties of the tail.

  • Reduced Fertility: Consequences for fertility ranging from subtle reductions in fertilization efficiency to complete infertility, depending on the severity of the mutation.

  • Strain-Specific Effects: As observed with other ODF proteins, the impact of mutations might vary between different genetic backgrounds .

To directly investigate these implications, approaches such as CRISPR/Cas9-mediated gene editing to create Odf4 mutant models, or correlation studies between Odf4 variants and fertility parameters in humans or animal models would be valuable.

How can recombinant Odf4 be used in in vitro reconstitution studies of sperm tail structure?

Recombinant Odf4 can be a powerful tool for in vitro reconstitution studies, allowing researchers to examine the assembly and properties of sperm tail structures:

  • Self-Assembly Studies: Purified recombinant Odf4 can be used to investigate whether the protein can self-assemble into fiber-like structures in vitro, similar to what has been observed with other cytoskeletal proteins.

  • Co-Assembly with Other ODF Proteins: Combining recombinant Odf4 with other purified ODF proteins (Odf1, Odf2) can reveal hierarchy and dependencies in fiber formation.

  • Binding Partner Identification: Immobilized recombinant Odf4 can be used as bait in pull-down assays to identify novel interacting proteins from testicular or sperm extracts.

  • Structural Studies: Purified recombinant protein can be used for X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of Odf4 and its complexes.

  • Mechanical Property Analysis: Reconstituted fibers containing Odf4 can be subjected to biophysical measurements to determine their elastic properties and contribution to sperm tail mechanics.

Using recombinant proteins with specific mutations or truncations can further reveal the importance of particular domains or residues in these processes.

What methodologies are most effective for solubilizing and purifying native Odf4 from rat sperm samples?

Based on information from the search results and general protein purification principles, effective methodologies for solubilizing and purifying native Odf4 from rat sperm samples would include:

  • Sample Preparation: Collect rat sperm from epididymis or testicular tissue. For sperm tail-specific proteins, separation of tails from heads may improve purification specificity.

  • Initial Solubilization: ODF proteins are typically insoluble in conventional buffers due to their fibrous nature and disulfide bonding. Based on methods used for similar proteins, treatment with 1% SDS followed by incubation at 50°C can assist in solubilizing the protein pellet .

  • Alternative Solubilization Methods:

    • Urea (6-8M) treatment

    • Guanidine hydrochloride (6M)

    • Reducing agents like DTT or β-mercaptoethanol to disrupt disulfide bonds

  • Purification Strategies:

    • Immunoaffinity chromatography using Odf4-specific antibodies

    • Ion exchange chromatography

    • Size exclusion chromatography

    • Affinity-tagged recombinant proteins for comparative studies

  • Verification: Western blotting and mass spectrometry to confirm identity and purity of the isolated Odf4.

Each of these approaches may require optimization for Odf4 specifically, as the protein may have unique solubility and stability characteristics compared to other ODF proteins.

What are common challenges in generating functional antibodies against Odf4?

Generating functional antibodies against Odf4 may present several challenges:

  • Cross-Reactivity: ODF proteins can share structural similarities, potentially leading to antibody cross-reactivity. This has been observed between FS14 and ODF14, which immunocrossreact with each other on western blots . Careful epitope selection and extensive validation are essential to ensure specificity.

  • Conformational Epitopes: If important epitopes depend on protein folding or post-translational modifications, antibodies raised against recombinant proteins may not recognize the native form.

  • Accessibility in Fixed Tissues: The dense structure of the sperm tail may limit antibody accessibility in immunolocalization studies, requiring optimization of fixation and permeabilization protocols.

  • Species Cross-Reactivity: If antibodies need to recognize Odf4 across species for comparative studies, epitope conservation must be considered during antibody design.

To address these challenges, strategies may include:

  • Using multiple distinct epitopes to generate a panel of antibodies

  • Employing both polyclonal and monoclonal approaches

  • Rigorous validation using multiple techniques (western blot, immunoprecipitation, immunofluorescence)

  • Including appropriate positive and negative controls, including Odf4-knockout samples if available

What factors affect the reproducibility of experiments using recombinant Odf4?

Several factors can affect the reproducibility of experiments using recombinant Odf4:

  • Protein Quality and Stability: Recombinant Odf4 should be stored appropriately (-20°C or -80°C for extended storage) in suitable buffer conditions (Tris-based buffer with 50% glycerol) . Avoiding repeated freeze-thaw cycles is critical for maintaining protein integrity.

  • Batch-to-Batch Variability: Different production batches may vary in purity, folding, or post-translational modifications, affecting experimental outcomes.

  • Tag Influence: The presence and type of affinity tags can impact protein folding, activity, or interactions. According to product information, "The tag type will be determined during production process" , suggesting potential variability.

  • Buffer Composition: The specific buffer components and pH can significantly affect protein behavior in experimental systems.

  • Experimental Conditions: Temperature, incubation time, and presence of other proteins or cellular components may influence Odf4 behavior in experiments.

To enhance reproducibility, researchers should:

  • Thoroughly document all experimental conditions

  • Use consistent sources and batches of recombinant protein when possible

  • Include appropriate controls in each experiment

  • Validate key findings using multiple experimental approaches

How can researchers distinguish between specific and non-specific effects when manipulating Odf4 expression in cellular or animal models?

Distinguishing between specific and non-specific effects when manipulating Odf4 expression requires rigorous experimental design and appropriate controls:

  • Multiple Knockdown/Knockout Approaches: Using different methodologies (siRNA, shRNA, CRISPR/Cas9) targeting distinct regions of the Odf4 gene can help confirm that observed phenotypes are specifically due to Odf4 depletion rather than off-target effects.

  • Rescue Experiments: Reintroducing wild-type Odf4 into knockout cells or animals should restore the normal phenotype if effects are specific. Using mutagenized Odf4 variants can further define functional domains.

  • Dose-Dependency Analysis: Examining whether phenotypic effects correlate with the degree of Odf4 depletion or overexpression.

  • Temporal Control: Using inducible expression or knockout systems can help distinguish between developmental and functional roles.

  • Specificity Controls: Examining the expression and localization of other ODF proteins to ensure that manipulation of Odf4 doesn't cause global disruption of sperm tail structures.

  • Comparative Phenotyping: Comparing phenotypes resulting from Odf4 manipulation with those from manipulation of other ODF proteins (e.g., Odf1, Odf2) can reveal specific versus general ODF disruption effects.

Experience with gene trap mutations of ODF proteins has shown the importance of thorough analysis, as disruption of genes like Odf2 can have varied effects depending on the insertion site and genetic background .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.