Recombinant Rat OX-2 membrane glycoprotein (Cd200)

Shipped with Ice Packs
In Stock

Description

Functional Properties

CD200 binds its inhibitory receptor CD200R to suppress proinflammatory cytokine release and immune cell activation via DOK2/RasGAP signaling . Recombinant CD200 retains this functionality:

  • Binding Affinity: Binds CD200R with a dissociation constant (K<sub>d</sub>) of ~4 μM (surface plasmon resonance at 37°C) .

  • Specificity: No binding observed to activating receptors (CD200RLa, CD200RLb, CD200RLc) .

Table 1: Ligand-Binding Specificity of Recombinant CD200

ReceptorBinding AffinityFunctional Outcome
CD200RK<sub>d</sub> = 4 μMInhibits myeloid cell activation
CD200RLaNo bindingNo activation signal
CD200RLbNo bindingNo activation signal

Production and Purification

Recombinant Rat CD200 is produced via bacterial expression systems :

  • Expression Host: E. coli (tag-free or His-tagged) .

  • Purity: >90% (SDS-PAGE) .

  • Bioactivity Validated: Functional ELISA confirms binding to CD200R .

Immunoassays

  • ELISA Kits: Used to quantify CD200 in rat serum, plasma, and tissue homogenates (detection range: 78–5,000 pg/mL) .

  • Flow Cytometry: Anti-CD200 antibodies (e.g., clone OX-2) block CD200-mediated T-cell costimulation .

Mechanistic Studies

  • Immune Regulation: Suppresses mast cell degranulation and macrophage activation .

  • Therapeutic Potential: CD200-Fc fusion proteins show efficacy in arthritis and transplant models .

Key Research Findings

  1. Structural Insights:

    • The V-like domain of CD200 forms a concave interface with CD200R, excluding carbohydrates from binding .

    • Viral CD200 homologs (e.g., herpesviruses) mimic host CD200 to evade immune detection .

  2. In Vitro Studies:

    • Recombinant CD200 inhibits IFN-γ/TNF-α-driven macrophage activation via RasGAP recruitment .

    • No cross-reactivity with activating receptors ensures specificity for immune suppression .

  3. In Vivo Implications:

    • Elevated soluble CD200 correlates with tumor immunosuppression in glioblastoma and leukemia .

Discussion

Recombinant Rat CD200 serves as a critical tool for dissecting immune checkpoint pathways and developing immunotherapies. Its lack of glycosylation in bacterial systems does not impede receptor binding, suggesting conformational epitopes dominate interactions . Future studies should explore its therapeutic potential in autoimmune diseases and cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cd200; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; CD antigen CD200
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-278
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QVEVVTQDERKLLHTTASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKAHGVVIQPTYKDRINITELGLLNTSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGSGIENSTESHSHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK
Uniprot No.

Target Background

Function
This protein acts as a costimulator of T-cell proliferation. It may also regulate myeloid cell activity in various tissues.
Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Found on the surface of neurons, thymocytes, B-cells and follicular dendritic cells.

Q&A

What is Rat OX-2 membrane glycoprotein (CD200) and what are its structural features?

Rat CD200 (OX-2) is a type I membrane glycoprotein belonging to the immunoglobulin protein superfamily. It contains two immunoglobulin superfamily domains and is expressed on the cell surface of various cell types. The molecule functions primarily as an immunoregulatory protein, delivering immunosuppressive signals through binding to its receptor, CD200R .

Structurally, CD200 is expressed as a 43-kDa molecule and consists of an extracellular domain, a transmembrane region, and a cytoplasmic tail. The extracellular portion contains the immunoglobulin-like domains that facilitate interaction with CD200R .

What is the cellular distribution pattern of CD200 in rat tissues?

CD200 has a distinctive distribution pattern in rat tissues. It is prominently expressed on:

  • Thymocytes

  • Neurons

  • Follicular dendritic cells

  • Vascular endothelium

  • Kidney glomeruli

  • At low levels on some B cells and smooth muscle cells

This distribution pattern is remarkably conserved across species, with human CD200 showing a similar expression profile. The broad but not ubiquitous expression suggests CD200 plays regulatory roles in multiple tissue environments .

How does the CD200-CD200R system regulate immune function?

The CD200-CD200R ligand system plays a crucial role in controlling macrophage and granulocyte activation. When CD200 binds to CD200R, which is expressed on monocytes/myeloid cells and T lymphocytes, it delivers immunosuppressive signals that downregulate myeloid cell activity .

This interaction has significant implications for immune regulation in anatomically diverse locations. Research demonstrates that CD200-CD200R signaling can suppress antitumor immune responses, suggesting that manipulation of this pathway may have therapeutic potential in various disease contexts .

What are the validated methods for detecting CD200 expression in rat samples?

Several validated methods exist for detecting CD200 expression in rat samples:

Flow Cytometry: Mouse anti-Rat CD200 antibody (clone OX-2) is routinely tested by flow cytometry on rat thymocytes. Expression can be evaluated semiquantitatively by comparison with isotype PE control antibody and designated as either negative or positive with varying intensity levels (1+, 2+, or 3+) .

Western Blotting: For protein-level detection in tissue lysates, using purified IgG preparations of anti-CD200 antibodies.

Immunohistochemistry: For tissue-based detection, particularly useful for examining CD200 expression in fixed tissues.

ELISA: Sandwich ELISA methods can quantitatively determine CD200 or CD200R1 concentrations in serum, plasma, cell culture supernatant, and other biological samples with detection ranges typically around 31.25-2000pg/ml and sensitivity of approximately 18.75pg/ml .

How can researchers generate functional monoclonal antibodies against rat CD200?

Generating functional monoclonal antibodies against rat CD200 involves several critical steps:

  • Immunization Strategy: Use purified recombinant rat CD200 or CD200-expressing cells (like rat thymocytes) as immunogens.

  • Hybridoma Development: After immunization, harvest spleen cells and fuse with myeloma cells to create hybridomas.

  • Screening Process: Screen for antibody production using techniques such as:

    • ELISA against recombinant CD200

    • Flow cytometry using CD200-expressing cells (e.g., rat thymocytes)

    • Testing on CHO cells transfected with adenovirus vectors expressing rat OX-2 gene

  • Functional Validation: Confirm antibody specificity and functionality by:

    • Testing blocking capability in T cell co-stimulation assays

    • Confirming recognition of the appropriate epitope

    • Assessing cross-reactivity with CD200 from other species if desired

  • Production and Purification: Produce the monoclonal antibody at scale and purify using affinity chromatography on Protein A from tissue culture supernatant .

What experimental considerations are important when using recombinant rat CD200 in functional assays?

When using recombinant rat CD200 in functional assays, researchers should consider:

  • Proper Controls: Include isotype controls and blocking antibodies to confirm specificity of observed effects.

  • Concentration Optimization: Determine optimal concentrations through titration experiments, as both too low and too high concentrations may yield misleading results.

  • Buffer Compatibility: Ensure compatibility with assay buffers, as preservation stabilizers like sodium azide (commonly used at 0.09%) may interfere with certain functional assays .

  • Storage Conditions: Maintain protein integrity by following recommended storage conditions (typically 2-8°C for antibodies in solution) .

  • Validation of Biological Activity: Confirm that the recombinant protein retains biological activity by testing its ability to bind CD200R and induce expected downstream signaling effects.

How does CD200 expression influence T cell responses in experimental settings?

CD200 has significant effects on T cell responses in experimental settings:

  • T Cell Co-stimulation: Mouse anti-Rat CD200 antibody (clone OX-2) has been shown to block OX-2 mediated T cell co-stimulation, indicating that CD200 provides co-stimulatory signals in certain contexts .

  • Cytokine Polarization: In mixed leukocyte reactions, when cells are cultured with species-specific anti-CD200 monoclonal antibodies, cytokine production becomes polarized away from type-2 cytokine production, with preferentially increased expression of type-1 cytokines .

  • Immunosuppressive Environment: CD200-CD200R interactions create an immunosuppressive microenvironment that can dampen effector T cell responses. This has important implications in tumor immunology, where CD200 expression by tumor cells can suppress antitumor T cell responses .

These findings suggest that targeted manipulation of CD200-CD200R interactions could be a strategy for modulating T cell responses in various immunological contexts.

What is the role of CD200 in neuroinflammatory conditions?

CD200 plays a crucial role in neuroinflammatory regulation due to its expression pattern:

  • Neuronal Expression: CD200 is prominently expressed on neurons in the rat brain .

  • Microglial Regulation: The CD200-CD200R axis is essential for controlling microglial activation. Microglia express CD200R, and interaction with neuronally-expressed CD200 helps maintain microglia in a quiescent state.

  • Protective Function: The neuron-specific expression of CD200 provides a protective mechanism against inappropriate microglial activation in the healthy brain.

  • Therapeutic Potential: Targeting the CD200-CD200R pathway has emerged as a potential therapeutic strategy for neuroinflammatory conditions. Enhancing CD200 signaling may help reduce harmful inflammatory responses in neurodegenerative diseases.

The conserved expression pattern of CD200 in neurons across species (including humans) suggests that findings in rat models may have translational relevance for human neuroinflammatory diseases .

How does CD200 expression correlate with disease progression in hematological malignancies?

CD200 expression has important implications in hematological malignancies:

  • Diagnostic Value: CD200 is overexpressed in chronic lymphocytic leukemia (CLL) and hairy cell leukemia (HCL) but not in mantle cell lymphoma (MCL), making it useful for differential diagnosis of these B-cell malignancies .

  • Expression Stability: Analysis of CD200 expression stability shows that approximately 81% of patients with plasma cell myeloma (PCM) maintained stable expression levels over time, while about 19% showed significant modulation (mostly downregulation) of expression .

  • Gene Expression Correlation: CD200-negative PCMs demonstrated significantly higher gene risk scores compared to those with 2+ CD200 positivity (p<0.0006), suggesting a potential correlation with disease aggressiveness .

  • Prognostic Significance: While CD200 has clear diagnostic utility, its prognostic value remains somewhat controversial. Some studies suggest prognostic implications while others indicate that CD200 expression does not appear to have a relevant role as a prognostic indicator in CLL according to currently available data .

  • Therapeutic Target: The immunosuppressive properties of CD200 have made it an attractive therapeutic target. A first-in-human study using the anti-CD200 antibody samalizumab in CLL patients showed promising results, with decreased tumor burden observed in 14 CLL patients and stable disease in 16 patients .

What are common challenges in detecting rat CD200 and how can they be addressed?

Researchers frequently encounter several challenges when detecting rat CD200:

  • Low Expression Levels: CD200 expression can be low on certain cell types like B cells and smooth muscle cells.

    • Solution: Use high-sensitivity detection methods such as enhanced chemiluminescence for Western blots or amplification steps in immunohistochemistry.

  • Cross-Reactivity Issues: Some antibodies may cross-react with related proteins.

    • Solution: Validate antibody specificity using CD200 knockout tissues or cells when available, or through competitive binding assays.

  • Background Signal: Particularly in immunohistochemistry applications.

    • Solution: Optimize blocking conditions and thoroughly titrate primary and secondary antibodies.

  • Preservation of Epitopes: Some fixation methods may alter CD200 epitopes.

    • Solution: Compare multiple fixation techniques (paraformaldehyde, methanol, acetone) to determine optimal preservation of the target antigen.

  • Flow Cytometry Gating Challenges: Establishing proper gating for CD200+ populations.

    • Solution: Use isotype PE control antibodies for accurate comparison and establish clear definitions for positivity (e.g., 1+, 2+, 3+ based on log shifts in mean fluorescence intensity) .

How can researchers ensure reproducibility when working with recombinant rat CD200?

Ensuring reproducibility with recombinant rat CD200 requires attention to several factors:

  • Consistent Source and Preparation:

    • Use recombinant proteins from the same vendor when possible

    • Document the batch number for reference in publications

    • Avoid mixing reagents from different kits or batches

  • Standardized Storage and Handling:

    • Adhere to manufacturer recommendations (typically 2-8°C for sealed boxes)

    • Avoid repeated freeze-thaw cycles

    • Document storage conditions in experimental protocols

  • Validation of Activity:

    • Regularly test functionality through binding assays

    • Verify protein integrity via SDS-PAGE before experimental use

  • Detailed Protocol Documentation:

    • Record all experimental conditions including buffer compositions

    • Document exact incubation times and temperatures

    • Standardize data collection parameters across experiments

  • Appropriate Controls:

    • Include both positive and negative controls in each experiment

    • Consider using reference standards for quantitative comparisons

What strategies can be employed to study CD200-CD200R interactions in complex experimental systems?

Studying CD200-CD200R interactions in complex experimental systems requires sophisticated approaches:

  • Co-culture Systems:

    • Establish co-cultures of CD200-expressing cells with CD200R-expressing myeloid cells

    • Measure changes in myeloid cell activation markers, cytokine production, and phagocytic activity

    • Include appropriate controls (CD200-negative cells, blocking antibodies)

  • FRET-based Interaction Analysis:

    • Tag CD200 and CD200R with compatible fluorophores

    • Monitor protein-protein interactions through Förster Resonance Energy Transfer

    • Useful for real-time visualization of interactions in living cells

  • Conditional Expression Systems:

    • Develop inducible expression systems for CD200 to study temporal aspects of signaling

    • Use tissue-specific promoters to restrict expression to particular cell types

  • Chimeric Receptor Approaches:

    • Generate chimeric proteins combining the extracellular domain of CD200 with alternative transmembrane/intracellular domains

    • Helps dissect specific signaling pathways activated by CD200-CD200R binding

  • In vivo Imaging:

    • Label CD200 or CD200R with bioluminescent or fluorescent tags

    • Monitor distribution and interactions in living animals

    • Particularly valuable for studying neuroinflammatory conditions where CD200 is expressed on neurons

How might CD200-targeted therapies benefit neuroinflammatory and neurodegenerative conditions?

CD200-targeted therapies show promise for neuroinflammatory and neurodegenerative conditions:

  • Microglial Regulation: Since CD200 expressed on neurons interacts with CD200R on microglia to maintain microglial quiescence, enhancing this signaling could potentially reduce harmful microglial activation in conditions like Alzheimer's disease and Parkinson's disease.

  • Blood-Brain Barrier Protection: CD200 is expressed on vascular endothelium, suggesting that modulating CD200 signaling might help preserve blood-brain barrier integrity during neuroinflammatory events .

  • Therapeutic Approaches:

    • Recombinant CD200-Fc fusion proteins could augment endogenous CD200 signaling

    • Small molecule agonists of CD200R could bypass the need for CD200 expression

    • Cell-based therapies delivering enhanced CD200 expression to inflammatory sites

  • Combination Strategies: CD200-targeted approaches might be most effective when combined with other neuroprotective or anti-inflammatory treatments, potentially allowing for lower doses of each agent and reduced side effects.

The conserved expression pattern of CD200 across species makes findings from rat models particularly relevant for potential human therapeutic applications .

What is the current understanding of CD200 as a therapeutic target in oncology?

CD200 has emerged as a promising therapeutic target in oncology:

  • Immunosuppressive Microenvironment: CD200 expression by tumor cells creates an immunosuppressive microenvironment that can dampen anti-tumor immune responses. Studies have demonstrated that CD200 expression by tumor cells suppresses antitumor responses in animal models .

  • Clinical Development: The first-in-human study investigating the recombinant humanized monoclonal anti-CD200 antibody samalizumab in patients with advanced CLL and multiple myeloma showed promising results:

    • Treatment was associated with mild to moderate adverse events

    • Resulted in a dose-dependent decrease in CD200 expression on CLL cells

    • Decreased tumor burden in 14 CLL patients

    • One patient achieved a durable partial response

    • 16 patients maintained stable disease

  • Mechanism of Action: Anti-CD200 antibodies like samalizumab function as immune checkpoint inhibitors, blocking the immunosuppressive signal normally delivered through CD200-CD200R interaction.

  • Potential Applications: Beyond CLL and HCL, CD200-targeted therapies might be beneficial in other CD200-expressing malignancies and could potentially be combined with other immunotherapeutic approaches for synergistic effects .

  • Biomarker Potential: CD200 expression levels might serve as a biomarker to identify patients most likely to benefit from CD200-targeted therapies or other immunotherapeutic approaches.

How does CD200 expression influence macrophage polarization and function?

CD200 has significant effects on macrophage polarization and function:

  • Polarization Influence: When cells are cultured with species-specific anti-CD200 monoclonal antibodies in mixed leukocyte reactions, cytokine production becomes polarized away from type-2 cytokine production, with preferentially increased expression of type-1 cytokines .

  • M1/M2 Balance: CD200-CD200R interactions generally promote an M2-like (anti-inflammatory) phenotype in macrophages. Disruption of this signaling can shift macrophages toward a more M1-like (pro-inflammatory) state.

  • Tissue-Specific Effects: The broad distribution of CD200 across various tissues suggests that CD200-mediated macrophage regulation may have tissue-specific functions and consequences.

  • Therapeutic Implications: Manipulating CD200-CD200R signaling could be a strategy for reprogramming tumor-associated macrophages in cancer therapy or modulating macrophage responses in inflammatory diseases.

  • Research Tools: Recombinant rat CD200 and anti-CD200 antibodies serve as valuable tools for investigating these effects in experimental settings, allowing for the precise control of CD200-CD200R signaling in various macrophage populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.