Recombinant Rat Oxytocin receptor (Oxtr)

What is the amino acid sequence of full-length rat Oxytocin receptor?

The full-length rat Oxytocin receptor (Oxtr) consists of 388 amino acids (P70536). The complete sequence is: MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACVLLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDVNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETSVSKKSNSSTFVLSRRSSSQRSCSQPSSA .

What expression systems are suitable for producing recombinant rat Oxtr?

While E. coli is commonly used for expressing rat Oxtr with N-terminal His tags , expression systems should be selected based on experimental requirements. E. coli systems are advantageous for high protein yield and cost-effectiveness but lack post-translational modifications. For functional studies requiring proper receptor folding and membrane insertion, mammalian expression systems like HEK293T cells are preferred, as they provide native-like processing mechanisms . For structural studies requiring high purity, insect cell systems (Sf9, High Five) offer a middle ground between bacterial and mammalian expression.

How should recombinant rat Oxtr be stored to maintain stability?

Recombinant rat Oxtr protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For reconstituted protein, store working aliquots at 4°C for up to one week. The recommended storage buffer is Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, add glycerol to a final concentration of 5-50% (50% is standard) and aliquot before storing at -20°C/-80°C .

What visualization techniques are effective for studying rat Oxtr distribution in neural tissues?

Modern visualization of rat Oxtr in neural tissues requires sophisticated approaches that preserve endogenous expression patterns. The epitope tagging strategy with C-terminally fused tags has proven effective for visualizing Oxtr protein distribution on neural membranes using super-resolution imaging . Earlier reporter strategies like the Oxtr-Venus knock-in mouse line showed limitations with expression decreasing during development, likely due to disruption of endogenous regulatory elements .

For optimal visualization results, combine:

• Epitope tagging (HA-tags) for super-resolution microscopy

• T2A self-cleaving peptide with fluorescent reporters (tdTomato) for cellular localization

• Ensure intact preservation of endogenous transcriptional regulations

• Validate expression patterns with electrophysiological recordings from reporter-positive cells

How can genetic tools be used to manipulate Oxtr-expressing neurons?

Genetic manipulation of Oxtr-expressing neurons can be achieved through several sophisticated approaches:

• Cre recombinase systems: Using knock-in mouse lines with codon-improved Cre recombinase (iCre) driven by the endogenous Oxtr promoter enables selective manipulation of Oxtr-expressing neurons. This approach maintains endogenous transcriptional regulation while allowing for viral vector-dependent functional analyses .

• Inducible systems: Spatiotemporally controlled manipulation can be achieved using Cre-ERT2 systems activated by tamoxifen administration, allowing for precise temporal control of recombination events .

• Viral vector delivery: Retro-orbital injections of AAV-PHP.eB vectors into Cre driver lines enable visualization and manipulation of Oxtr-expressing neurons in specific brain regions .

For optimal results, ensure that genetic modifications preserve the endogenous genomic configuration, including intronic and 3' UTR sequences, which contain essential transcriptional regulatory elements.

What are the key binding parameters for rat Oxtr and how do they compare across species?

Rat Oxtr binding parameters are comparable to those observed across species, with remarkable homogeneity in OXT-OXTR affinity. Meta-analysis of OXT-OXTR binding reveals a range of dissociation constants (Kd) between 0.52-9.32 nM, with a mean Kd of 1.48 ± 0.51 nM across experiments and species . For myometrial OXT-OXTR specifically:

These parameters are critical for designing experiments and interpreting data, particularly when comparing results across different model systems or cell types .

What OXT concentrations are required for maximum receptor occupancy in different cell types?

OXT concentration requirements for maximum receptor occupancy vary significantly between cell types:

• Myometrial cells: Maximum Oxtr occupancy is achieved at approximately 10 nM OXT

• HEK293T cells: Require approximately 1 μM OXT for maximum occupancy

This 100-fold difference in concentration requirements between cell types highlights the importance of considering cell-specific factors when designing experiments. Researchers should adjust OXT concentrations based on their specific cell type to ensure appropriate receptor activation .

How do genetic variants affect OXT-OXTR binding and what are the implications for experimental design?

Genetic variants of Oxtr demonstrate significant functional differences in OXT-OXTR binding capacity:

These effects are observed across multiple OXT concentrations (10 pM, 10 nM, 1 μM), with the largest differences at 1 μM OXT where maximal OXTRC formation occurs. Variants P108A and L206V show significant overlap in complex formation capacity, suggesting similar functionality .

The substantial impact of these variants has important implications for experimental design:

• Researchers should genotype their model systems

• Adjust OXT dosing protocols based on specific variants

• Consider the temporal dynamics of receptor activation, particularly for variants with reduced binding capacity

• Account for variant-specific differences when comparing results across studies

Can reduced OXT-OXTR binding in genetic variants be rescued with modified dosing strategies?

For variants with reduced binding capacity (V281M and E339K), modified dosing strategies can partially rescue receptor activation. Mathematical modeling suggests:

• V281M variant:

  • 2.5 μM OXT can achieve wild-type level activation for the first 24 seconds (0.4 min)

  • 4.5 μM OXT can exceed wild-type activation for up to 45 seconds (0.75 min)

• E339K variant:

  • 1.5 μM OXT achieves wild-type activation for the first 36 seconds (0.6 min)

  • 2.5 μM OXT exceeds wild-type activation for up to 90 seconds (1.5 min)

How can endogenous transcriptional regulation be preserved when creating genetic tools for studying Oxtr?

Preserving endogenous transcriptional regulation is critical for generating reliable genetic tools for Oxtr research. Previous approaches, such as the Oxtr-Venus knock-in mouse that replaced the first coding exon with Venus sequences, showed expression decline during development due to disruption of regulatory elements .

Recommended approaches include:

• Targeted genome editing: Use CRISPR/Cas9 with crRNA/tracrRNA complex and targeting vectors to insert modifications just upstream of the stop codon, preserving the gene's regulatory architecture .

• Preserve intronic and 3' UTR sequences: Maintain these regions intact as they contain essential transcriptional regulatory elements for spatiotemporally coordinated Oxtr expression.

• T2A self-cleaving peptide strategy: This allows expression of additional proteins (reporters, recombinases) while maintaining endogenous Oxtr expression patterns.

• Validation of expression profiles: Confirm proper expression through methods like electrophysiological recordings from reporter-positive cells and comparing with known Oxtr expression patterns .

What are the methodological considerations for developing mathematical models of OXT-OXTR binding?

Developing robust mathematical models for OXT-OXTR binding requires careful consideration of multiple parameters:

• Cell-specific measurements: Parameterize models with cell-specific OXTR surface localization measurements, as receptor density varies significantly between cell types.

• Binding kinetics determination: Incorporate accurate binding kinetics (kon, koff, Kd) derived from meta-analyses of binding experiments across studies and species to ensure reliability.

• Time-course considerations: Account for both early binding events (seconds to minutes) and equilibrium states (hours), as cellular responses like Ca^2+ release manifest within minutes but long-term effects may differ.

• Genetic variant modeling: Include specific parameters for genetic variants that alter binding capacity to predict their functional consequences.

• Validation against experimental data: Calibrate and validate models using experimental measurements from multiple cell types and conditions.

• Sensitivity analysis: Determine which parameters most significantly affect model predictions to guide experimental design .

What quality control methods should be used to verify recombinant rat Oxtr integrity?

Multiple quality control methods should be employed to verify recombinant rat Oxtr integrity:

• SDS-PAGE analysis: Verify protein purity (should be greater than 90%) and expected molecular weight .

• Western blotting: Confirm protein identity using anti-His antibodies for His-tagged proteins or specific anti-Oxtr antibodies.

• Mass spectrometry: Verify protein sequence and identify any post-translational modifications or truncations.

• Functional binding assays: Confirm binding capacity with radiolabeled or fluorescently labeled oxytocin.

• Receptor autoradiography: For tissue samples, verify distribution patterns of functional receptors .

• Circular dichroism: Assess secondary structure integrity, particularly important for membrane proteins.

For recombinant proteins used in sensitive applications, additional validation with surface plasmon resonance or isothermal titration calorimetry may be warranted to confirm binding parameters.

How can researchers address issues with poor expression or functionality of recombinant rat Oxtr?

Poor expression or functionality of recombinant rat Oxtr can be addressed through systematic troubleshooting:

• Expression system optimization:

  • For bacterial systems: Adjust induction conditions (temperature, IPTG concentration, duration)

  • For mammalian systems: Consider codon optimization or use of chaperones

  • Test different fusion tags (N-terminal vs. C-terminal His tag)

• Solubilization and folding:

  • For membrane proteins, optimize detergent selection and concentration

  • Consider addition of small molecular chaperones

  • Test refolding protocols if expressed in inclusion bodies

• Protein stability:

  • Adjust buffer composition (pH, salt concentration, additives)

  • Add stabilizing agents like glycerol (5-50%) or trehalose (6%)

  • Aliquot immediately after purification to avoid freeze-thaw cycles

• Functional assessment:

  • For non-functional protein, verify structural integrity through biophysical methods

  • Test binding with varying concentrations of oxytocin to establish dose-response

  • Compare binding parameters with literature values (Kd = 1.48 ± 0.51 nM)