Recombinant Rat P2Y purinoceptor 13 (P2ry13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat P2Y Purinoceptor 13

Recombinant Rat P2Y purinoceptor 13 (P2ry13) is a laboratory-produced form of the naturally occurring P2Y13 receptor found in Rattus norvegicus. This receptor belongs to the family of G-protein coupled receptors that respond to extracellular nucleotides, particularly adenosine diphosphate (ADP). The P2Y13 receptor is a member of the purinergic receptor family, which contains several receptor subtypes with varying pharmacological selectivity for adenosine and uridine nucleotides. Specifically, the P2Y13 receptor is activated by ADP and represents one of the latest P2Y receptors identified .

The recombinant form of this receptor enables detailed investigation of its structure, function, and potential applications in research and therapeutic development. Understanding the properties and roles of P2ry13 contributes significantly to our knowledge of purinergic signaling in both physiological and pathological conditions, with implications for neurological, immunological, and metabolic processes.

Genetic Homology and Evolution

Rat P2Y13 receptor demonstrates significant sequence homology with its orthologs in other mammalian species. Specifically, rat P2Y13 is 79% identical to the human P2Y13 receptor and 87% identical to the mouse P2Y13 receptor at the amino acid level . This high degree of conservation suggests important evolutionary preservation of function across mammalian species. The strong sequence homology among P2Y12, P2Y13, and P2Y14 receptor genes supports their evolutionary origin through gene duplication events .

Recombinant Expression Systems

The production of Recombinant Rat P2Y purinoceptor 13 can be achieved through various expression systems, each offering distinct advantages depending on research requirements. Common expression systems include:

Expression SystemCharacteristicsApplications
E. coliHigh-yield, cost-effective productionStructural studies, antibody production
YeastPost-translational modificationsFunctional studies
BaculovirusSuitable for membrane proteinsLigand binding studies
Mammalian cellsNative-like receptor activitySignaling pathway analysis
HEK293Human cell line for expressionFunctional studies

These expression systems provide researchers with flexibility in producing recombinant P2ry13 tailored to specific experimental needs, from basic structural studies to complex functional analyses.

Tissue-Specific Expression

Rat P2Y13 receptor exhibits a distinctive tissue distribution pattern that offers valuable insights into its physiological roles. Expression studies reveal highest P2ry13 levels in the spleen, followed by liver and brain tissues . Within the brain, particularly high expression is observed in the cortex and striatum regions, mirroring the distribution pattern reported in humans .

This expression profile strongly suggests important roles for P2Y13 receptors in both the nervous and immune systems. The significant presence in brain regions indicates neurological functions, while the high expression in spleen, a major lymphoid organ, points to potential functions in immune regulation and response.

Cellular Distribution

At the cellular level, P2ry13 expression has been documented in primary rat astrocytes at levels comparable to those of other cloned P2Y receptors . This finding suggests a potential role for P2Y13 receptors in reactive astrogliosis, a process that occurs following central nervous system injury or disease. The presence of this receptor in astrocytes may contribute to neuroprotective mechanisms and neuroinflammatory responses.

Ligand Binding and Activation

The pharmacological profile of rat P2Y13 receptor exhibits both similarities and differences compared to its human and mouse orthologs. When expressed in 1321N1 cells, recombinant rat P2Y13 responds to the typical P2Y13 receptor agonists ADP and 2-methylthio-ADP (2MeSADP) .

Interestingly, unlike both human and mouse P2Y13 receptors, the rat P2Y13 receptor shows higher potency for ADP compared to 2MeSADP . This species-specific pharmacological difference is important to consider when using rat models for P2Y13 receptor research and drug development. Other nucleotides and sugar-nucleotides have been shown to be ineffective at activating the rat P2Y13 receptor, demonstrating its selectivity for ADP and close derivatives .

Antagonist Sensitivity

Recombinant rat P2Y13 receptor activation by ADP and 2MeSADP can be completely inhibited by nanomolar concentrations of AR-C69931MX, a known P2Y antagonist . In contrast, the selective P2Y1 receptor antagonist MRS2179 does not inhibit rat P2Y13 receptor activity, highlighting the pharmacological differentiation between P2Y receptor subtypes .

For experimental purposes, the antagonist MRS2211 has been used to target P2Y13 receptors, although at high doses it may lose selectivity and potentially block other P2Y receptors (P2Y1, P2Y12) as well . These pharmacological tools enable detailed investigation of P2ry13 function in various experimental settings.

G-Protein Coupling and Primary Signaling

The rat P2Y13 receptor primarily couples to Gi/o proteins, leading to inhibition of adenylate cyclase and subsequent decrease in cyclic AMP (cAMP) production . This has been demonstrated through studies showing that pertussis toxin pre-treatment abolishes the agonist effects of ADP and 2MeSADP on rat P2Y13 receptors .

Interestingly, the signaling capacity of recombinant rat P2Y13 is enhanced in cells co-transfected with the Gα16 subunit, indicating the receptor's ability to couple with multiple G-protein subtypes . This versatility in G-protein coupling contributes to the diverse cellular responses mediated by P2Y13 activation.

Alternative Signaling Pathways

Beyond the canonical Gi/o-protein coupled pathway, the P2Y13 receptor demonstrates remarkable versatility in its signaling capabilities. Several alternative transduction pathways have been identified:

Signaling PathwayMechanismCellular Effect
PI3K/Akt/GSK3 axisPhosphorylation leading to release of β-catenin and Nrf2Promotion of cell survival
Gαq couplingIncrease in intracellular Ca²⁺ and activation of phospholipase C/PKC/ERK/CREB7DUSP2Regulation of cellular responses
βγ subunit activationActivation of RhoADecrease in Ca²⁺ sensitivity
MAPK pathwaysActivation of mitogen-activated protein kinasesRegulation of gene expression

This signaling versatility likely contributes to the diverse physiological functions of P2Y13 receptors across different tissues and cell types, enabling context-specific cellular responses to ADP.

Nervous System Functions

The high expression of P2Y13 receptors in the rat brain, particularly in the cortex and striatum, indicates important neurological functions. Studies suggest roles in:

  1. Neuroprotection: P2Y13 receptor activation may contribute to neuronal survival mechanisms following injury or stress .

  2. Pain transmission: Evidence indicates involvement in modulating nociceptive signaling pathways, suggesting potential applications in pain management .

  3. Neuromodulation: The receptor likely participates in the regulation of neurotransmitter release and neuronal excitability within specific brain regions .

  4. Astrocyte function: Expression in astrocytes suggests roles in reactive astrogliosis and neuroinflammatory responses .

These neurological functions position P2Y13 as a potentially important target for neurodegenerative diseases and neurological disorders.

Metabolic Functions

Studies using P2Y13 receptor knockout mice have highlighted important metabolic functions that may also be relevant to the rat ortholog. These include:

  1. Cholesterol metabolism regulation: P2Y13 appears to play a role in cholesterol homeostasis and reverse cholesterol transport .

  2. Glucose metabolism: Evidence suggests involvement in glucose regulation and energy homeostasis .

  3. Bone homeostasis: P2Y13 has been implicated in bone formation and remodeling processes .

While these functions have been primarily demonstrated in mouse models, the high sequence homology between mouse and rat P2Y13 receptors (87%) suggests similar roles likely exist in rats .

Available Recombinant Products

Various commercial providers offer recombinant rat P2Y13 receptor products for research purposes:

ProviderProductExpression SystemFormat
Creative BioMartRecombinant Full Length Rat P2Y Purinoceptor 13, His-TaggedE. coliProtein
CusabioRecombinant Rat P2Y purinoceptor 13 (P2ry13)in vitro E. coli expression systemProtein
CusabioRecombinant Rat P2Y purinoceptor 13 (P2ry13), partialMultiple systems (Yeast, E. coli, Baculovirus, Mammalian)Protein

These recombinant products facilitate various research applications including functional studies, antibody production, and drug screening.

Experimental Applications

Recombinant Rat P2Y purinoceptor 13 serves as an important tool for various research applications:

  1. Screening for selective P2Y13 receptor ligands and development of pharmacological tools

  2. Structure-function relationship studies to understand receptor mechanics

  3. Investigation of P2Y13-mediated signaling pathways in various cell types

  4. Development of rat models for P2Y13-related pathologies

  5. Comparative studies between rat, human, and mouse P2Y13 receptors

These applications contribute to our understanding of purinergic signaling and its roles in health and disease.

Pathological Relevance

P2Y13 receptors become particularly relevant in various pathological conditions including hypoxia, heart failure, hypertension, sepsis, atherosclerosis, tissue damage, and inflammation . At the endothelial level, P2Y13 receptors (along with P2Y12) can influence vascular permeability, thrombosis, and angiogenesis under pathological conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
P2ry13; P2Y purinoceptor 13; P2Y13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNST FIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETMYVGIMMLGLI AFDRFLKIVVPFRKTFVKKTAFAKIVSISIWLLMFLISLPNMILNKEATASTVKKCASLK SPLGLLWHQVVSHTCQFIFWTVFILMLLFYTVIAKKVYDSYRKFKSRDSKHKRLEAKVFI VMAVFFVCFAPFHFVRVPYTHSQTTNKTDCRLENQLFLAKESTLFLATTNICMDPLIYII LCKKFTRKVPCMRWRTKTAASSDEHHSSQTDNITLS
Uniprot No.

Target Background

Function
P2Y13 is an ADP receptor coupled to G(i)-proteins. It is implicated in hematopoiesis and immune system function.
Gene References Into Functions

Further Research on P2Y13 Receptor Function:

  1. ADP's impact on intracellular calcium in cultured dorsal spinal cord microglia may involve P2Y13 receptor activation. (PMID: 25186167)
  2. P2Y13 receptors modulate DUSP2 expression and contribute to p38 signaling homeostasis and neuronal survival. (PMID: 24851838)
  3. P2Y13 receptor involvement in suppressing neuronal differentiation suggests its antagonists as potential neurodegenerative disease treatments. (PMID: 22521313)
  4. ADP-induced calcium mobilization and Hex release in RBL-2H3 cells occur via P2Y(1) and P2Y13 receptors, respectively. (PMID: 20813187)
  5. P2Y13 receptor plays a previously unidentified role in inducing the Nrf2/HO-1 antioxidant response and protecting against oxidative stress. (PMID: 20447456)
  6. Rat P2Y13 receptor exhibits similarities and differences compared to its human and mouse orthologs. (PMID: 15183123)
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest levels in spleen, liver brain and kidney. Lower but significant level are also detected in intestine, stomach, skeletal muscle, testis, heart and lung.

Q&A

What is the basic structure and function of rat P2Y purinoceptor 13?

Rat P2Y purinoceptor 13 (P2ry13) is a G-protein coupled receptor that primarily functions as a receptor for adenosine diphosphate (ADP). The receptor consists of 337 amino acids with a molecular weight of approximately 38.7 kDa and contains characteristic seven-transmembrane domains typical of G-protein coupled receptors. P2ry13 specifically couples to Gi proteins, which inhibit adenylyl cyclase activity upon activation, resulting in decreased intracellular cyclic adenosine monophosphate (cAMP) levels . This signaling pathway distinguishes it from other P2Y receptors that may couple to different G proteins. Functionally, P2ry13 may play significant roles in hematopoiesis and immune system regulation, though its expression patterns and functions can vary across tissues compared to other P2Y receptor subtypes .

How does rat P2ry13 differ from other P2Y receptor subtypes in terms of pharmacological profile?

Rat P2ry13 exhibits a distinctive pharmacological profile that differentiates it from other P2Y receptor subtypes. Unlike P2Y2 and P2Y4 receptors that respond strongly to both ATP and UTP with similar potencies, P2ry13 demonstrates high specificity for ADP as its primary endogenous agonist . This contrasts with the pharmacological profile observed in P2Y2/P2Y4 receptors where the rank order of agonist potency is typically ATP ≥ UTP > UTPγS = ATPγS >> 2MeSADP .

P2ry13 is relatively insensitive to UDP, UTP, and ATP compared to ADP. In terms of antagonist sensitivity, P2ry13 exhibits different patterns from P2Y2/P2Y4, which show variable sensitivity to PPADS and suramin. These pharmacological differences are crucial for designing selective experimental protocols when studying P2Y receptor subtypes in isolation, particularly in tissues expressing multiple purinergic receptors such as the urinary bladder .

What expression systems are commonly used for recombinant rat P2ry13 production?

Several expression systems have proven effective for recombinant rat P2ry13 production, each offering distinct advantages depending on research objectives. Mammalian expression systems, particularly HEK-293 cells, represent the gold standard for functional studies as they provide proper post-translational modifications and protein folding essential for receptor pharmacology . For high-throughput screening or structural studies, cell-free protein synthesis (CFPS) systems have gained popularity due to their efficiency and ability to produce proteins with specific purification tags such as His-tag or Strep-tag .

For biochemical characterization and antibody production, wheat germ expression systems offer advantages for producing specific domains or full-length P2ry13. The choice of expression system significantly impacts protein yield, functionality, and downstream applications, with HEK-293 cells typically achieving >90% purity as determined by techniques such as Bis-Tris PAGE and analytical SEC (HPLC) . Each system requires optimization of codon usage, signal sequences, and purification strategies specific to rat P2ry13.

What are the optimal methods for assessing rat P2ry13 expression in native tissues versus recombinant systems?

Assessing rat P2ry13 expression requires distinct methodological approaches depending on whether examining native tissues or recombinant systems. For native tissue expression, a multi-technique approach yields the most reliable results. Quantitative real-time PCR represents the foundation for expression studies, allowing precise quantification of P2ry13 mRNA relative to housekeeping genes such as β-actin . Western blotting using validated antibodies can confirm protein expression, with expected bands for P2ry13 appearing at approximately 38.7 kDa .

For more detailed localization studies, immunohistochemistry or immunofluorescence with co-localization markers provides spatial information about receptor distribution across tissue compartments. When working with recombinant P2ry13, expression verification typically employs anti-tag ELISA, Western blot with tag-specific antibodies, and analytical SEC (HPLC) . Functional verification through calcium imaging or cAMP assays provides critical confirmation that the recombinant receptor maintains proper signaling capabilities. The integration of multiple techniques strengthens expression analysis, as single methods may yield inconsistent results due to antibody specificity issues or variable receptor density across tissues.

How can researchers optimize transfection efficiency for recombinant rat P2ry13 expression in mammalian cells?

Optimizing transfection efficiency for recombinant rat P2ry13 expression in mammalian cells requires systematic adjustment of multiple parameters. Begin by selecting appropriate expression vectors containing strong promoters (CMV or EF1α) and codon-optimized P2ry13 sequences for rat proteins. For HEK-293 cells, which demonstrate high transfection efficiency for P2ry13, lipid-based transfection reagents typically yield superior results compared to calcium phosphate methods .

Key optimization parameters include:

ParameterRecommended RangeNotes
DNA concentration0.5-2 μg per well (6-well plate)Excess DNA can be cytotoxic
DNA:lipid ratio1:2 to 1:4Requires empirical determination
Cell density70-80% confluenceCritical for maximum efficiency
Serum conditionsReduced serum (0-2%) during transfectionFull serum can inhibit transfection
Post-transfection time48-72 hoursOptimal for P2ry13 expression

For stable cell line generation, antibiotic selection should begin 48 hours post-transfection, with concentrations determined through kill curves. Single-cell cloning and subsequent screening by Western blot and functional assays ensures uniform receptor expression. Inclusion of molecular chaperones or growth at reduced temperatures (30-32°C) can enhance proper folding of recombinant P2ry13 receptors that may otherwise accumulate in the endoplasmic reticulum .

What are the critical considerations for purifying recombinant rat P2ry13 while maintaining its functional integrity?

Purifying recombinant rat P2ry13 while maintaining functional integrity presents significant challenges due to its multi-transmembrane domain structure. The purification strategy must be carefully designed to preserve native conformation throughout the process. Initial solubilization requires screening multiple detergents, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin typically providing the best balance between extraction efficiency and protein stability .

The purification workflow should include:

  • Affinity chromatography utilizing the incorporated tag (His or Strep) with optimized imidazole or desthiobiotin elution gradients to minimize non-specific binding

  • Size exclusion chromatography to separate monomeric receptor from aggregates

  • Optional ion exchange chromatography for removing contaminating proteins

Throughout purification, buffer composition requires careful attention to maintain receptor stability:

ComponentRecommended RangePurpose
pH7.2-7.6Maintains native conformation
NaCl150-300 mMReduces non-specific interactions
Glycerol10-20%Enhances protein stability
Detergent1-2× CMCPrevents aggregation
Lipids0.01-0.1 mg/mLStabilizes native structure

For functional studies, reconstitution into proteoliposomes or nanodiscs has proven effective in restoring and preserving receptor activity. Quality assessment should include purity verification (>90% by SDS-PAGE), homogeneity (analytical SEC), and functional validation through ligand binding assays .

How can researchers effectively design calcium mobilization assays to study rat P2ry13 signaling?

Designing effective calcium mobilization assays for rat P2ry13 signaling requires careful consideration of its G-protein coupling properties. Unlike P2Y2/P2Y4 receptors that couple primarily to Gq and directly mobilize intracellular calcium, P2ry13 couples to Gi proteins, which do not directly trigger calcium release . Therefore, the experimental design must account for this signaling difference.

For effective calcium mobilization studies:

  • Use chimeric G-protein constructs (such as Gαqi5) to redirect signaling from Gi to calcium pathways

  • Alternatively, measure calcium signals generated through Gβγ subunits released from activated Gi

  • Employ a promiscuous G-protein (Gα16) to couple the receptor to phospholipase C

The assay setup should include:

ComponentSpecificationPurpose
Calcium indicatorFluo-4 AM or Calcium 6High sensitivity for transient signals
Buffer compositionLow calcium (1-2 mM)Reduces background
Positive control2MeSADP or ADPConfirms receptor functionality
Negative controlVehicle and P2Y1 antagonistEliminates contribution of endogenous receptors
Data acquisitionKinetic mode, 1-2 readings/secCaptures rapid and transient signals

Unlike the robust calcium responses observed with P2Y2/P2Y4 receptors, P2ry13 signals may be more subtle, requiring higher sensitivity settings and careful data analysis. Concentration-response curves should be generated with ADP (1 nM to 100 μM) to determine EC50 values, which can be compared across experimental conditions .

What experimental approaches best elucidate the role of rat P2ry13 in purinergic signaling networks in neural tissues?

Elucidating the role of rat P2ry13 in neural purinergic signaling networks requires an integrated experimental approach that addresses both expression patterns and functional consequences. Begin with precise anatomical mapping of P2ry13 expression in neural tissues using in situ hybridization and immunohistochemistry with neuronal subtype markers to identify specific populations expressing the receptor. This approach should be complemented by functional studies in primary neuronal cultures and acute brain slices.

For mechanistic studies in neural tissues:

  • Electrophysiology: Whole-cell patch-clamp recordings in identified neurons can detect P2ry13-mediated changes in membrane potential, firing patterns, and synaptic transmission when stimulated with selective agonists

  • Live calcium imaging: Multiphoton imaging in acute brain slices can map functional responses across neural networks

  • Microdialysis: In vivo sampling of neurotransmitter release following P2ry13 modulation

For establishing physiological relevance, employ genetic approaches such as:

ApproachMethodologyReadout
RNA interferenceshRNA delivered via viral vectorsRegion-specific knockdown effects
CRISPR/Cas9Guide RNAs targeting P2ry13Complete or conditional knockout
OptogeneticsCombined with P2ry13 modulationTemporal control of purinergic signaling

These approaches reveal not only where P2ry13 is expressed but how it modulates neural function. Unlike P2Y2 receptors that are extensively characterized in neural tissues including sub-urothelial nerve bundles , the specific roles of P2ry13, particularly in modulating inhibitory neurotransmission through its Gi-coupling, require further investigation.

How does rat P2ry13 interact with other purinergic receptors in coordinating physiological responses?

Rat P2ry13 functions within a complex network of purinergic signaling, interacting with other purinergic receptors to coordinate nuanced physiological responses. Unlike P2Y2 receptors that predominantly trigger calcium mobilization leading to ATP release in urothelial cells , P2ry13 exerts inhibitory effects through Gi-protein coupling, creating a potential counterbalance within the purinergic signaling network .

The interaction occurs at multiple levels:

  • Co-expression patterns: P2ry13 is often co-expressed with other purinergic receptors, creating signaling microdomains where responses to extracellular nucleotides are integrated

  • Signaling crosstalk: Activation of P2ry13 can modulate signaling from P2Y1, P2Y2, and P2X receptors through altered cAMP levels and PKA activity

  • Receptor heteromerization: Evidence suggests physical interaction between certain P2Y receptors, potentially including P2ry13, altering pharmacological properties

The coordinated function can be studied using:

ApproachApplicationOutcome Measurement
Multi-electrode arraysNeural network activityFiring patterns after selective activation
FRET-based biosensorsProtein-protein interactionsDirect receptor associations
Conditional knockout modelsTissue-specific deletionIsolated physiological contributions

In tissues expressing multiple purinergic receptors, the inhibitory action of P2ry13 likely serves as a regulatory mechanism that shapes the temporal dynamics of purinergic signaling. This is in contrast to the predominantly excitatory effects of P2Y2/P2Y4 receptors observed in tissues like the urothelium , suggesting complementary roles in maintaining signaling homeostasis.

How should researchers interpret discrepancies between mRNA and protein expression data for rat P2ry13?

Discrepancies between mRNA and protein expression data for rat P2ry13 are common and require careful interpretation. Such discrepancies have been observed in studies of other P2Y receptors, where western blotting indicated variable P2Y4 protein expression despite consistent mRNA detection . These inconsistencies stem from multiple biological and technical factors that must be systematically addressed.

Several factors contribute to mRNA-protein discrepancies:

  • Post-transcriptional regulation: microRNAs may specifically target P2ry13 mRNA, reducing translation efficiency

  • Protein stability: Varying half-lives between different P2Y receptors affect steady-state levels

  • Receptor trafficking: Membrane receptors undergo constitutive internalization and degradation

  • Technical limitations: Antibody specificity issues may yield false negatives in protein detection

To resolve these discrepancies, implement a comprehensive validation strategy:

ApproachApplicationResolution
Absolute quantification PCRPrecise mRNA copy numbersEstablishes baseline expression
Multiple antibody validationWestern blot with different epitopesConfirms protein detection
Epitope-tagged constructsTransfection of tagged P2ry13Controls for antibody limitations
Proteasome/lysosome inhibitorsBlocked protein degradationReveals turnover dynamics

In the context of P2Y receptor research, these discrepancies might reflect physiological regulation rather than experimental artifacts. For instance, in studies of P2Y4 expression in rat urinary bladder, protein was detectable in only 1/3 samples despite consistent mRNA detection , suggesting regulated expression rather than technical failure.

What are the major technical challenges in differentiating between P2ry13 and other ADP-responsive purinergic receptors in functional assays?

Differentiating between rat P2ry13 and other ADP-responsive purinergic receptors in functional assays presents significant technical challenges due to overlapping pharmacological profiles. This differentiation is particularly challenging given that multiple P2Y receptors (P2Y1, P2Y12, and P2ry13) all respond to ADP as their primary agonist, yet couple to different G-proteins and produce distinct downstream effects.

To overcome these challenges, employ a multi-faceted approach:

  • Pharmacological discrimination: Utilize selective antagonists and the subtle differences in agonist potency profiles

  • G-protein pathway isolation: Employ pathway-specific inhibitors and biosensors

  • Genetic manipulation: Use siRNA knockdown or CRISPR-mediated knockout

A systematic antagonist approach can be particularly effective:

ReceptorSelective AntagonistWorking ConcentrationG-protein Coupling
P2Y1MRS25001-10 nMGq
P2Y12AR-C69931MX0.1-1 μMGi
P2ry13MRS22111-10 μMGi

By applying these antagonists sequentially or in combination, the contribution of each receptor subtype can be isolated. Additionally, differential activation of downstream signaling pathways can be monitored simultaneously using multiplexed assays that track calcium mobilization (P2Y1) versus cAMP inhibition (P2Y12, P2ry13) . This approach has successfully distinguished between P2Y receptor subtypes in tissues expressing multiple purinergic receptors.

How can researchers troubleshoot non-specific binding issues when conducting radioligand binding assays with recombinant rat P2ry13?

Radioligand binding assays with recombinant rat P2ry13 frequently encounter non-specific binding challenges that can obscure specific binding signals. These issues arise from the physicochemical properties of nucleotide ligands and the complexity of membrane preparations containing the recombinant receptor. Systematic troubleshooting approaches can significantly improve signal-to-noise ratios.

Critical parameters requiring optimization include:

  • Membrane preparation quality: Higher purity reduces non-specific binding sites

  • Buffer composition: Ionic strength and pH significantly impact non-specific interactions

  • Radioligand selection: [³H]-2MeSADP typically offers better signal-to-noise than [³H]-ADP

  • Filtration vs. centrifugation separation: Different techniques may yield varying results

Implement the following optimization strategy:

ParameterOptimization ApproachExpected Improvement
Membrane proteinTitrate 1-50 μg per assayDetermines optimal protein concentration
Wash bufferTest increased NaCl (150-500 mM)Disrupts ionic non-specific interactions
Blocking agentsAdd 0.1-0.5% BSAReduces non-specific sites
FiltrationCompare GF/B vs. GF/C filtersDifferent retention properties
Pre-soaking filters0.1-0.5% polyethylenimineReduces filter binding

Additionally, comprehensive competition binding with unlabeled ligands should include both known P2ry13 ligands and ligands selective for other P2Y receptors to ensure binding specificity. Unlike some better-characterized P2Y receptors, P2ry13 binding assays remain technically challenging, requiring careful validation with both positive and negative controls to confirm that the measured binding represents the intended target receptor rather than other purinergic receptors that may be endogenously expressed in the expression system .

What emerging technologies might advance our understanding of rat P2ry13 receptor structure-function relationships?

Emerging technologies offer unprecedented opportunities to deepen our understanding of rat P2ry13 receptor structure-function relationships. Unlike P2Y2 receptors, which have been extensively characterized , structural insights into P2ry13 remain limited. Several cutting-edge approaches are poised to address this knowledge gap:

  • Cryo-electron microscopy (Cryo-EM) has revolutionized GPCR structural biology, potentially allowing visualization of P2ry13 in different conformational states without the need for crystallization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into ligand-induced conformational changes and allosteric regulation

  • Advanced computational approaches, including molecular dynamics simulations spanning microsecond timescales, can reveal dynamic aspects of receptor function

Implementation strategies include:

TechnologyApplication to P2ry13Expected Insights
Single-particle Cryo-EMStructure determination in nanodiscsNative-like lipid environment structures
Protein engineeringThermostabilizing mutationsEnhanced stability for structural studies
AI structure predictionAlphaFold2/RoseTTAFold integrationComplementary to experimental approaches
Molecular dynamicsLigand binding pathway studiesBinding kinetics and conformational changes

These technologies will help elucidate how structural differences between P2ry13 and other P2Y receptors, such as P2Y2 and P2Y4, contribute to their distinct pharmacological profiles and physiological roles . Understanding these structure-function relationships will facilitate the development of highly selective ligands for P2ry13, advancing both basic research and potential therapeutic applications.

How might single-cell transcriptomics advance our understanding of P2ry13 expression patterns across different rat tissues and physiological states?

Single-cell transcriptomics offers transformative potential for mapping rat P2ry13 expression patterns with unprecedented cellular resolution. Unlike bulk RNA analysis, which revealed general P2Y receptor distribution patterns in tissues such as the urothelium , single-cell approaches can identify specific cell populations expressing P2ry13 and characterize co-expression patterns with other receptors and signaling molecules.

This technology can address several fundamental questions:

  • Which specific cell types within heterogeneous tissues express P2ry13?

  • How does expression change during development or disease states?

  • What co-expression patterns might indicate functional relationships with other signaling systems?

Implementation strategies include:

ApproachApplicationExpected Outcome
scRNA-seq (10X Genomics)Comprehensive tissue profilingCell type-specific expression maps
Spatial transcriptomicsRegional expression patternsAnatomical context of expression
CITE-seqProtein and mRNA co-detectionCorrelation between transcript and protein
Trajectory analysisDevelopmental profilingTemporal regulation patterns

These approaches will reveal whether P2ry13 shows similar cell-type specificity to other P2Y receptors, such as the preferential expression of P2Y2 in all urothelial layers versus the more restricted distribution of P2Y4 . Understanding the precise cellular localization of P2ry13 will provide crucial insights into its physiological roles across different tissues and how these functions might complement or contrast with other purinergic receptors.

What key considerations should researchers keep in mind when planning experiments investigating rat P2ry13 function?

When planning experiments investigating rat P2ry13 function, researchers should carefully consider several critical factors that impact experimental design and interpretation. First, the expression pattern of P2ry13 must be clearly established in the tissue or cell system under investigation, as expression levels can vary significantly between tissues and may not correlate directly with mRNA levels, as observed with other P2Y receptors . This necessitates validation using multiple techniques.

Second, the pharmacological complexity of purinergic signaling demands careful control experiments to distinguish P2ry13-specific effects from those mediated by other purinergic receptors. Unlike P2Y2/P2Y4 receptors that respond primarily to ATP/UTP , P2ry13 responds to ADP but shares this ligand with other receptors, requiring selective antagonists and genetic approaches for definitive attribution of observed effects.

Third, the downstream signaling pathways linked to P2ry13 activation (primarily Gi-mediated) differ fundamentally from those of Gq-coupled P2Y receptors, necessitating appropriate readouts such as cAMP inhibition rather than calcium mobilization . These considerations are essential for generating reliable and interpretable data that advances our understanding of P2ry13's physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.