Recombinant Rat P2Y purinoceptor 4 (P2ry4)

Shipped with Ice Packs
In Stock

Description

Expression and Production

Recombinant P2ry4 is synthesized via heterologous expression systems, with variations in host organisms influencing functional properties:

Host SystemReactivityApplications
E. coliHigh yield, bacterial expressionStructural studies, antibody production
YeastEukaryotic post-translational modificationsFunctional assays, ligand binding studies
Mammalian cellsNative folding, membrane integrationReceptor activity assays, signaling pathway analysis

Partial-length constructs (e.g., truncated extracellular domains) are also available for specific experimental needs .

Pharmacological Profile

P2ry4 exhibits species-specific agonist/antagonist selectivity:

Agonists

NucleotidePotency (rP2Y4)Human P2Y4 Comparison
ATPHigh (EC₅₀ ~1–10 µM)Antagonist
UTPHigh (EC₅₀ ~1–10 µM)Agonist (EC₅₀ ~10 µM)
CTPModerate (EC₅₀ ~10–50 µM)Inactive
GTPWeak (EC₅₀ >50 µM)Inactive
Ap4AFull activationPartial activation

Key Findings:

  • Rat P2Y4 is activated by ATP, UTP, CTP, GTP, and ITP, with equipotency observed in some studies .

  • Dinucleotides like Ap4A fully activate rP2Y4, unlike human P2Y4 .

Antagonists

CompoundEffect on rP2Y4Selectivity
Reactive Blue 2Blocks ATP/UTP responsesSuramin-insensitive
PPADSWeak inhibition (IC₅₀ >1 mM)Broad P2 receptor antagonist
SuraminNo effectSelective for P2Y2

Functional Roles in Rat Physiology

P2ry4 is implicated in diverse physiological processes:

SystemFunctionEvidence
UrotheliumATP release, modulation of micturition reflex via P2Y2/4 co-expression Calcium imaging, luciferin-luciferase assays
InflammationMediates pro-inflammatory responses in astrocytes (via PGE2) P2Y4 activation upregulates cytokines (e.g., TNF-α, IL-6)
NeuroprotectionModulates synaptic plasticity and presynaptic cytosolic calcium RGD database associations with ATP binding and synaptic regulation

Experimental Models

ApplicationMethodOutcome
Receptor-Ligand BindingRadioligand assays (e.g., [³²P]UTP)Quantification of nucleotide affinity
Signaling StudiesCalcium imaging, PLC-β activation assaysGq/11-mediated IP3/Ca²⁺ signaling
Drug DiscoveryHigh-throughput screening for P2Y4-specific antagonists/agonistsIdentification of MRS4062 (P2Y4 antagonist)

Species-Specific Considerations

ParameterRat P2Y4Human P2Y4
ATP RoleAgonist Antagonist
Suramin SensitivityInsensitive Sensitive
Zn²⁺ ModulationActivates receptor (low µM) Not reported

References

  1. MyBioSource: Recombinant Rat P2Y4 Products

  2. PMC: Pharmacological Divergence of rP2Y2/4 Receptors

  3. RGD: P2ry4 Gene Associations

  4. Creative Biolabs: P2Y4 in Inflammation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
P2ry4; P2y4; P2Y purinoceptor 4; P2Y4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTSAESLLFTSLGPSPSSGDGDCRFNEEFKFILLPMSYAVVFVLGLALNAPTLWLFLFRL RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKFVRFLFYWNLYCSVL FLTCISVHRYLGICHPLRAIRWGRPRFASLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL CHDTTLPEEFDHYVYFSSAVMVLLFGLPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL RTIAVVLTVFAVCFVPFHITRTIYYQARLLQADCHVLNIVNVVYKVTRPLASANSCLDPV LYLFTGDKYRNQLQQLCRGSKPKPRTAASSLALVTLHEESISRWADTHQDSTFSAYEGDR L
Uniprot No.

Target Background

Function
P2Y4 is a receptor for ATP and UTP that is coupled to G-proteins. It activates a phosphatidylinositol-calcium second messenger system. It is not activated by ADP or UDP.
Gene References Into Functions
  1. Activation of P2Y2/4 receptors, coupled to protein kinase signaling pathways, regulates amyloid precursor protein (APP) production and secretion, as demonstrated in astrocytes, a potential source of APP. PMID: 21300137
  2. Immunostaining of pancreas from streptozotocin-diabetic rats revealed the presence of P2Y4 receptors on both alpha and beta cells. PMID: 12850289
  3. Temporal changes in P2Y4 during cochlear development may play a role in establishing the endolymphatic ion composition required for normal auditory transduction and/or specific cellular differentiation. PMID: 17433586
  4. Expression of P2Y(4) receptors on rod bipolar cell axon terminals is reduced following dark adaptation, suggesting receptor expression may be influenced by retinal activity. PMID: 18625291
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed at low levels. In brain, higher expression in the pineal gland and ventricular system.

Q&A

What is rat P2Y4 purinoceptor and how does it differ from other P2Y receptors?

The rat P2Y4 receptor (rP2Y4) is a G protein-coupled metabotropic receptor that responds to extracellular nucleotides. It belongs to the P2Y receptor family which, along with P2X receptors (ligand-gated ion channels), constitute the main classes of purinergic receptors .

Key distinguishing characteristics:

  • rP2Y4 is primarily coupled to Gαq proteins, leading to PLC activation, IP3 generation, and intracellular Ca2+ mobilization

  • Unlike some other P2Y subtypes (P2Y1, P2Y12, P2Y13), rP2Y4 responds equally well to both ATP and UTP

  • The receptor shows distinctive pharmacological profiles compared to other P2Y subtypes, including unique responses to antagonists like Reactive Blue 2 (RB-2)

Methodological approach for identification: RT-PCR using specific primers for P2Y4 represents the standard method for identifying expression at the mRNA level. For example, primers designed based on published rat P2Y4 sequences from GenBank can be used with appropriate annealing temperatures (typically around 60°C) .

How does rat P2Y4 receptor differ from human P2Y4 receptor?

Despite >80% amino acid sequence identity, rat and human P2Y4 receptors exhibit significant pharmacological differences:

ParameterRat P2Y4Human P2Y4
ATP responseFull agonist (EC50 similar to UTP)Antagonist
UTP responseFull agonistFull agonist (primary ligand)
Nucleotide potencyATP=UTP=CTP=GTP=ITP (equipotent)UTP>ITP=GTP (ATP inactive as agonist)
Species homology>80% identical to human P2Y4>80% identical to rat P2Y4
Expression systemsSimilar pharmacology in oocytes, Jurkat cells, and 1321N1 cellsDifferent pharmacology depending on expression system

This species difference is significant and highlights that findings from rat models cannot be directly extrapolated to human P2Y4 function .

Methodological consideration: When designing experiments, researchers must consider these species-specific pharmacological differences, particularly when using nucleotide analogs or antagonists, as they may have different effects in rat versus human receptors .

What are the primary agonists and antagonists for rat P2Y4 receptors?

Agonist profile:

AgonistActivity at rP2Y4Relative PotencyNotes
ATPFull agonistEquipotent with UTPUnlike human P2Y4 where ATP is antagonist
UTPFull agonistEquipotent with ATPPrimary agonist for both rat and human P2Y4
CTPFull agonistEquipotent with ATP/UTPLess potent at P2Y2
GTPFull agonistEquipotent with ATP/UTPLess potent at P2Y2
ITPFull agonistEquipotent with ATP/UTP13-fold less potent at P2Y2
Ap4AFull agonistSimilar to ATPOnly diadenosine polyphosphate with full efficacy
ATPγSPartial agonistWeakFull agonist at P2Y2

Antagonist profile:

AntagonistActivity at rP2Y4PotencyNotes
Reactive Blue-2 (RB-2)Competitive antagonistpA2 = 6.43Most potent, can distinguish from P2Y2
BzATPAntagonistModerateActs as agonist at P2Y2
SuraminAntagonistLowCompetitive antagonist at P2Y2 (pA2 = 5.40)
PPADSAntagonistVery low (47% block at 10 mM)Less effective than at other P2Y subtypes
TNP-ATPInactive-P2X-selective antagonist

Methodological approach: When designing pharmacological experiments, researchers should use multiple selective compounds to verify receptor identity. The differential responses to RB-2, BzATP, and ATPγS can help distinguish rP2Y4 from rP2Y2 receptors .

What experimental methods can reliably distinguish between rat P2Y2 and rat P2Y4 receptors?

Since rat P2Y2 and P2Y4 receptors show similar responses to ATP and UTP, distinguishing between them requires multiple complementary approaches:

  • Differential nucleotide potency:

    • Test CTP, GTP and especially ITP, which shows 13-fold selectivity for P2Y4 over P2Y2

    • Test dinucleotides: P2Y4 is fully activated only by Ap4A, while P2Y2 responds to multiple dinucleotides (Ap3A, Ap4A, Ap5A, Ap6A)

  • Antagonist profiling:

    • RB-2 is a competitive antagonist at P2Y4 (pA2 = 6.43) but much less potent at P2Y2

    • Suramin potently blocks P2Y2 but is much less effective at P2Y4

  • Modulation by extracellular factors:

    • pH sensitivity: Acidification (pH 5.5-8.0) enhances agonist potency 8-10 fold at P2Y4 but not at P2Y2

    • Zinc sensitivity: Extracellular Zn2+ (0.1-300 μM) inhibits P2Y4 but not P2Y2 responses

  • Synthetic nucleotide responses:

    • BzATP activates P2Y2 but inhibits P2Y4

    • ATPγS fully activates P2Y2 but only weakly activates P2Y4

Experimental design recommendation: Researchers should use a combination of these approaches rather than relying on a single pharmacological tool to definitively identify the receptor subtype .

What is the expression pattern of P2Y4 receptors in rat tissues?

P2Y4 receptor expression has been detected in various rat tissues with specific distribution patterns:

TissueExpression LevelDetection MethodNotes
BrainModerate to highRT-PCR, ImmunohistochemistryWidely distributed in neurons and some glial cells
Intracardiac gangliaHighRT-PCR, Ca2+ imagingCo-expressed with P2Y2 receptors
RetinaHighImmunohistochemistry, EMPresent in rod bipolar cells and processes postsynaptic to cone bipolar cells
Liver (hepatocytes)High to moderateRT-qPCRAbundant in fresh isolates, decreased after overnight culture
Peripheral nervous systemModerateImmunohistochemistryPresent in sensory neurons

Methodological consideration: Expression levels can vary with tissue preparation methods and culture conditions. For instance, P2Y4 mRNA expression in hepatocytes decreased significantly after overnight culture compared to freshly isolated cells .

How can researchers effectively detect P2Y4 receptor expression in tissue samples?

Multiple complementary techniques should be employed for comprehensive detection:

  • mRNA detection:

    • RT-PCR using specific primers (see primer sequences in search result )

    • RT-qPCR with normalization to stable reference genes (e.g., RPL4)

    • In situ hybridization for spatial distribution within tissues

  • Protein detection:

    • Immunohistochemistry using validated antibodies

    • Western blotting for quantification

    • For specificity controls: preadsorption with blocking peptides and primary antibody omission

  • Functional assays:

    • Ca2+ imaging with selective agonists/antagonists

    • Electrophysiological recordings with pharmacological profiling

Methodological recommendation: Include appropriate controls for antibody specificity, such as preadsorption with blocking peptides and primary antibody omission controls. For nucleotide-based functional assays, include P2Y4-selective pharmacological tools to distinguish from other P2 receptors .

What are the primary signaling pathways activated by rat P2Y4 receptors?

The rat P2Y4 receptor primarily couples to Gαq/11 proteins, initiating the following signaling cascade:

  • Primary signaling pathway:

    • Activation of phospholipase C (PLC)

    • Generation of inositol 1,4,5-trisphosphate (IP3)

    • IP3-mediated Ca2+ release from intracellular stores

    • Subsequent activation of Ca2+-dependent processes

  • Secondary effectors:

    • Activation of Ca2+-activated K+ channels (in neurons)

    • Protein kinase C (PKC) activation

    • Modulation by phosphatidylinositol 4,5-bisphosphate (PIP2)

  • Unique signaling characteristics:

    • Unlike P2Y1-mediated Ca2+ oscillations, P2Y4-linked Ca2+ oscillations are less sensitive to negative regulation by PKC

    • P2Y4-linked Ca2+ oscillations are independent of Ca2+ influx, unlike P2Y1-linked responses

Methodological approach: To characterize these pathways, researchers can use:

  • Fura-2 loaded cells for Ca2+ imaging

  • Perforated patch whole-cell recordings to measure associated currents

  • Pharmacological inhibitors of PLC (U73122), IP3 receptors (2-APB), or PKC (GF109203X, Ro-31-8220)

How do extracellular factors modulate rat P2Y4 receptor function?

Several extracellular factors significantly modulate rat P2Y4 receptor function:

ModulatorEffect on P2Y4Experimental ConcentrationMethodological Notes
H+ (pH)Enhances agonist potencypH range 5.5-8.0 (8-10 fold enhancement at pH 5.5)Can be used to distinguish P2Y4 from P2Y2 (which is pH-insensitive)
Zn2+Inhibits agonist responses0.1-300 μMP2Y4-selective effect (P2Y2 is Zn2+-insensitive)
Ca2+Complex effectsmM rangeCan influence channel pore properties in P2X4 (a related purinergic receptor)

Experimental design considerations:

  • When studying P2Y4 function, buffer pH should be carefully controlled and reported

  • Zinc contamination from glassware or water sources should be minimized or controlled

  • For comparative studies between P2Y subtypes, these modulatory effects can be exploited as differentiating tools

What techniques are recommended for heterologous expression and characterization of recombinant rat P2Y4?

For successful heterologous expression and characterization of rat P2Y4:

  • Expression systems:

    • Xenopus oocytes: Ideal for electrophysiological studies and pharmacological characterization

    • Mammalian cell lines: 1321N1 cells (lacks endogenous P2 receptors), HEK293, or Jurkat cells

    • Expression vector recommendations: pCDNA3.1 or pEGFP-N1 for mammalian cells; pGEMHE for oocytes

  • Transfection/Expression methods:

    • For oocytes: Microinjection of cRNA (typically 5-10 ng/oocyte)

    • For mammalian cells: Lipofection, calcium phosphate precipitation, or electroporation

    • Verification of expression: RT-PCR, Western blotting, or reporter-tagged constructs

  • Functional characterization:

    • Two-electrode voltage clamp (for oocytes)

    • Calcium imaging using ratiometric dyes (Fura-2)

    • Inositol phosphate accumulation assays

    • Patch-clamp electrophysiology for associated currents

Methodological recommendation: When expressing P2Y4 receptors for pharmacological studies, researchers should adjust cRNA/cDNA amounts to achieve similar expression levels when comparing multiple receptor subtypes. This helps minimize the impact of receptor reserve on agonist potency measurements .

What is known about the role of P2Y4 receptors in developmental processes?

Studies in Xenopus embryos have revealed critical developmental functions of P2Y4 receptors:

  • Head formation:

    • P2Y4 depletion using TALEN-mediated knockout results in small head phenotypes

    • Disruption affects expression of neural crest marker snail1

    • Reduces expression of neural plate marker sox2 in the anterior region

    • Decreases expression of fore-midbrain marker otx2, retinal markers pax6/rx1, and hindbrain marker krox20

  • Gastrulation and morphogenetic movements:

    • P2Y4 disruption affects mesoderm involution during gastrulation

    • Can result in spina bifida phenotype

    • Distinct from P2Y11 which affects convergent extension but not involution

  • Head organizer function:

    • P2Y4 is required for expression of head organizer genes (dkk1 and cer)

    • Necessary but not sufficient for head organizer formation

Methodological approach for developmental studies: TALEN-mediated gene disruption, in situ hybridization for expression analysis of developmental markers, and rescue experiments with mRNA injection can be employed to study P2Y4 function in development .

How can researchers distinguish between P2Y4 receptor-mediated effects and those of other purinergic receptors in complex systems?

Distinguishing P2Y4-mediated effects in complex biological systems requires multiple complementary approaches:

  • Pharmacological differentiation strategy:

    • Use P2Y4-preferring agonist profiles: equal sensitivity to ATP, UTP, CTP, GTP, and ITP is characteristic of P2Y4

    • Apply selective antagonist patterns: RB-2 sensitivity combined with relative suramin resistance

    • Employ modulatory effects: test pH sensitivity (8-10 fold enhancement at acidic pH) and Zn2+ inhibition

  • Genetic approaches:

    • RNA interference (siRNA or shRNA) for selective knockdown

    • CRISPR/Cas9 or TALEN-mediated gene editing

    • Antisense oligonucleotides targeted to P2Y4-specific sequences

  • Expression correlation:

    • Correlate functional responses with P2Y4 expression levels across tissues

    • Use single-cell approaches to link receptor expression with functional readouts

  • Combinatorial exclusion:

    • Systematically eliminate other purinergic subtypes using selective tools

    • For example, use MRS2500 to block P2Y1, AR-C118925XX for P2Y2, MRS2578 for P2Y6, etc.

    • Complement with P2X blockers (TNP-ATP, PPADS) to eliminate ionotropic responses

Methodological recommendation: Researchers should employ at least two independent approaches (pharmacological and genetic) to confirm P2Y4-specific effects in complex systems where multiple purinergic receptors are expressed .

What are the current knowledge gaps and future research directions for rat P2Y4 receptors?

Despite significant advances in our understanding of P2Y4 receptors, several knowledge gaps remain:

  • Structural aspects:

    • Crystal structure of P2Y4 has not been resolved, unlike some other P2Y receptors

    • Detailed understanding of ligand binding sites and gating mechanisms remains incomplete

    • Structure-based drug design targeting P2Y4 is limited by this knowledge gap

  • Physiological roles:

    • Specific functions in different tissues remain incompletely characterized

    • Exact contribution to purinergic signaling in co-expression contexts with other P2 receptors

    • Detailed understanding of developmental roles beyond initial characterization

  • Pathophysiological significance:

    • Potential contributions to inflammatory processes

    • Possible roles in neuropathic pain similar to P2X4

    • Involvement in developmental disorders associated with defective head formation

Future research directions:

  • Development of truly selective pharmacological tools for P2Y4

  • Generation and characterization of tissue-specific conditional knockout models

  • Exploration of potential therapeutic applications by targeting P2Y4 in specific pathologies

  • Investigation of potential hetero-oligomerization with other P2Y or G protein-coupled receptors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.