Recombinant Rat Palmitoyltransferase ZDHHC18 (Zdhhc18)

Shipped with Ice Packs
In Stock

Description

2.1. Regulation of Innate Immunity

ZDHHC18 negatively regulates cGAS-mediated antiviral responses by:

  • Palmitoylating cGAS at C474, reducing DNA binding affinity

  • Inhibiting cGAS dimerization (FRET efficiency decreased by 40% with ZDHHC18 overexpression)

  • Attenuating TBK1/IRF3 phosphorylation in STING signaling

Table 1: Key functional data

ParameterEffect of ZDHHC18 ManipulationExperimental ModelSource
cGAS-DNA binding↓ 60% with overexpressionHEK293T cells
HSV-1 survival rate↑ 70% in Zdhhc18⁻/⁻ miceCRISPR-edited mice
IFN-β mRNA levels↑ 3.5-fold with ZDHHC18 knockdownHuman PBMCs

2.2. Neuronal Functions

While less characterized in rats, orthologous studies show:

  • Involvement in synaptic protein trafficking (e.g., PSD-95)

  • Sex-dependent expression patterns observed in rodent models

Research Applications

Recombinant ZDHHC18 has been utilized to study:

  • Immune regulation: Overexpression reduces cGAS activity by 45% in DNA-stimulated cells

  • Chemical interactions: Cadmium exposure increases ZDHHC18 palmitoylation via ROS pathways

  • Therapeutic targeting: Potential for autoimmune disease treatment by modulating cGAS activity

Table 2: Chemical modulators of ZDHHC18

CompoundEffect on ZDHHC18Experimental SystemSource
2-bromopalmitateInhibits palmitoylationRat hepatocytes
Cyclosporin A↑ mRNA expression 2.1-foldMouse liver
Nickel sulfate↑ mRNA expression 1.8-foldHuman epithelial cells

Experimental Models

Key systems used to characterize recombinant ZDHHC18:

  1. CRISPR/Cas9-edited rats:

    • Zdhhc18⁻/⁻ shows normal development but enhanced antiviral responses

  2. HEK293T overexpression:

    • Reduces cGAS-STING signaling by 65%

  3. Acyl-RAC assays:

    • Quantified 38% reduction in cGAS palmitoylation with ZDHHC18 knockdown

Challenges and Future Directions

  • Specificity issues: 16/23 ZDHHCs undergo auto-acylation, complicating substrate assignment

  • Therapeutic potential: Requires isoform-selective inhibitors to avoid off-target effects

  • Unresolved questions:

    • Structural basis for cGAS recognition

    • Cross-species conservation of regulatory mechanisms

Current research priorities include developing high-resolution structural models and tissue-specific knockout models to dissect ZDHHC18's roles in immunity and neurology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc18; Palmitoyltransferase ZDHHC18; Zinc finger DHHC domain-containing protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Zdhhc18
Target Protein Sequence
MKDCEYQQISPGAAPPPASPGVHRPGPAAPPGPSPGPAPGAPRWSVSGSGSGSGSGSGSL GRRPRRKWEVFPGRNRFYCGGRLMLAGHGGVFALTLLLILSTTILFFIFDCPYLARTLTL AIPIIAAILFFFVMSCLLQTSFTDPGILPRATICEAAALEKQIDNTGSSTYRPPPRTREV MINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFIL SLSFLTAFIFACVVTHLTLLSQGSNFLSALNKTPAGVLELVICFFSIWSILGLSGFHTYL VASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDT VLPSPIRSDEPACGAKPDASMVGGHP
Uniprot No.

Target Background

Function
Palmitoyltransferase catalyzes the addition of palmitate to various protein substrates. It palmitoylates HRAS and LCK. It may also exhibit palmitoyltransferase activity toward the beta-2 adrenergic receptor/ADRB2, thus regulating G protein-coupled receptor signaling.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZDHHC18 in cellular biology?

ZDHHC18 functions as a palmitoyltransferase that catalyzes the addition of palmitate to specific protein substrates, notably HRAS. In physiological contexts, ZDHHC18 regulates protein localization and activity through this post-translational modification. Research has demonstrated that ZDHHC18 catalyzes HRAS palmitoylation, which is pivotal for its translocation to the plasma membrane and subsequent activation of downstream signaling cascades .

Additionally, ZDHHC18 plays a regulatory role in innate immunity through its interaction with cGAS (cyclic GMP-AMP synthase). The palmitoyltransferase activity of ZDHHC18 mediates cGAS palmitoylation, resulting in reduced binding affinity of cGAS to double-stranded DNA and subsequent attenuation of innate immune responses .

How is ZDHHC18 expression altered in pathological conditions?

ZDHHC18 expression is significantly elevated in pathological conditions associated with renal fibrosis. Studies using unilateral ureteral obstruction (UUO) and folic acid-induced (FA-induced) renal fibrosis mouse models have demonstrated marked upregulation of ZDHHC18. This elevated expression pattern has been corroborated in fibrotic kidney tissue samples from patients with chronic kidney disease (CKD) .

The increased expression of ZDHHC18 in fibrotic conditions appears to be functionally significant, as tubule-specific deletion of ZDHHC18 attenuates tubular epithelial cells' partial epithelial-mesenchymal transition (EMT) and reduces production of profibrotic cytokines, ultimately alleviating tubulointerstitial fibrosis. Conversely, ZDHHC18 overexpression exacerbates progressive renal fibrosis, highlighting its pathological role .

What experimental models are available for studying ZDHHC18 function?

Several experimental models have been established for investigating ZDHHC18 function:

Model TypeDescriptionApplicationsReference
Knockout Mouse ModelZdhhc18^-/- mice generated via CRISPR/Cas9-mediated genome editing targeting exons 3-7In vivo assessment of physiological functions
Cell Culture ModelsPrimary tubular epithelial cells (PTECs) with ZDHHC18 knockout or overexpressionMechanistic studies and pathway analysis
Tissue-Specific KnockoutTubule-specific ZDHHC18 deletionAnalysis of cell-specific functions in fibrosis
Recombinant Protein SystemsExpression of wild-type and mutant (ZDHHC18(CS)) proteinsEnzyme activity assays and protein-protein interaction studies

When designing experiments, it's important to consider that ZDHHC18 functions may be compensated for by other ZDHHC family members (such as ZDHHC6 and ZDHHC9) in some contexts, as these enzymes can also catalyze similar palmitoylation reactions .

What are the molecular mechanisms underlying ZDHHC18-mediated regulation of renal fibrosis?

ZDHHC18 regulates renal fibrosis through a complex molecular pathway involving HRAS palmitoylation and subsequent signal transduction. The mechanistic pathway can be described as follows:

  • ZDHHC18 catalyzes the palmitoylation of HRAS at cysteine residues 181 and 184

  • This palmitoylation facilitates HRAS translocation to the plasma membrane

  • Membrane-localized HRAS activates downstream MEK/ERK phosphorylation

  • Activated MEK/ERK pathway promotes Ras-responsive element-binding protein 1 (RREB1)

  • RREB1 enhances SMAD binding to the Snai1 and Has2 cis-regulatory regions

  • This promotes transcription of EMT-related genes, driving fibrotic processes

Experimental evidence supports this mechanism, as mutation of the palmitoylation sites in HRAS (C181S and C184S) alleviates the partial EMT phenotype in proximal tubular epithelial cells (PTECs) . Furthermore, ZDHHC18 appears to serve as a critical link between TGF-β and RAS signaling pathways, as TGF-β1 promotes ZDHHC18 expression, creating a positive feedback loop that exacerbates fibrotic processes .

How does ZDHHC18 regulate innate immune responses through cGAS modification?

ZDHHC18 negatively regulates cGAS-mediated innate immunity through a palmitoylation-dependent mechanism. The detailed process involves:

  • ZDHHC18 catalyzes the palmitoylation of cGAS

  • This post-translational modification reduces cGAS binding affinity to double-stranded DNA

  • Reduced DNA binding inhibits cGAS dimerization and activation

  • Consequently, downstream signaling pathways including TBK1/IRF3 activation are suppressed

  • This leads to decreased type I interferon production (specifically IFN-β)

This regulatory mechanism has been substantiated through multiple experimental approaches. ISD (interferon-stimulatory DNA) pull-down assays demonstrate that ZDHHC18 overexpression abrogates cGAS-DNA complex formation in a dose-dependent manner. Importantly, a catalytically inactive ZDHHC18 mutant (ZDHHC18(CS)) with a cysteine-to-serine substitution in the DHHC motif fails to inhibit cGAS-DNA interaction, confirming the dependence on enzymatic activity .

Functional assays using IFN-β luciferase reporter systems further validate this mechanism, showing that ZDHHC18 significantly reduces cGAS/STING-mediated IFN-β promoter activation in a dose-dependent manner, while the ZDHHC18(CS) mutant rescues this negative phenotype .

What computational methods are most effective for predicting ZDHHC18-substrate interactions?

Advanced computational approaches have been employed to analyze ZDHHC18 interactions with its substrates. The most effective methods include:

Computational MethodApplicationKey ParametersReference
Molecular Dynamics SimulationsModeling ZDHHC18/cGAS/DNA complex dynamicsFree energy calculations, conformational analysis
Free Energy DecompositionQuantifying binding energies between protein complexesCalculation of ΔGbind as difference between total free energy of complex and sum of component energies
Principal Component Analysis (PCA)Identifying major functional motions in ZDHHC18-substrate complexesAnalysis of correlation coefficients (Cij) between residues

These computational approaches provide valuable insights into the structural basis of ZDHHC18-mediated palmitoylation. For example, PCA can identify correlated motions between specific residues, with positive Cij values indicating correlated motion and negative values representing inverse correlation .

When implementing these methods, researchers should consider that the accuracy of simulations depends heavily on parameter selection and simulation time. The binding free energy (ΔGbind) calculations are particularly useful for comparing the relative strength of different ZDHHC18-substrate interactions and can guide experimental validation strategies .

What are the optimal methodologies for generating and validating ZDHHC18 knockout models?

Generating reliable ZDHHC18 knockout models requires careful consideration of methodological approaches:

  • CRISPR/Cas9-mediated genome editing:

    • Target selection: Exons 3-7 of ZDHHC18 have been successfully targeted

    • Delivery method: Co-injection of Cas9 and guide RNA (gRNA) into fertilized eggs

    • Validation: PCR analysis of genomic DNA and sequencing to confirm deletions

    • Breeding strategy: Heterozygous intercrossing to generate homozygous knockouts

  • Considerations for phenotypic analysis:

    • Age standardization: 6-8 week old mice show consistent phenotypes

    • Sex differences: No significant differences in results between sexes have been reported

    • Controls: Littermate wild-type mice should be used as controls

    • Housing conditions: Specific pathogen-free animal facilities minimize confounding variables

  • Cell-specific knockout approaches:

    • For renal studies, tubule-specific deletion of ZDHHC18 provides targeted insights

    • This approach allows discrimination between direct effects on tubular epithelial cells versus secondary effects on other cell types

    • Cell-specific knockouts help elucidate tissue-specific functions and avoid developmental compensation mechanisms

When validating knockout models, researchers should assess both genomic modifications and functional consequences through comprehensive analyses of palmitoylation activity, target protein localization, and downstream signaling pathway activation.

What techniques are most effective for measuring ZDHHC18-mediated protein palmitoylation?

Several complementary techniques can be employed to assess ZDHHC18-mediated protein palmitoylation:

TechniqueDescriptionAdvantagesLimitations
Acyl-biotin exchange (ABE)Chemical conversion of palmitoyl thioester to biotin-labeled proteinsDetects endogenous palmitoylationIndirect measurement
Metabolic labelingIncorporation of alkyne-palmitate analogs into proteinsDirect visualization of newly palmitoylated proteinsRequires metabolic incorporation
Palmitoyl-proteomicsMass spectrometry-based identification of palmitoylated proteinsComprehensive profiling of multiple substratesResource intensive
Site-directed mutagenesisMutation of potential palmitoylation sites (e.g., HRAS C181S, C184S)Identifies specific palmitoylation sitesRequires candidate approach

For HRAS palmitoylation specifically, mutation of cysteine residues 181 and 184 to serine has proven effective in abrogating ZDHHC18-mediated palmitoylation, providing a valuable tool for functional validation studies .

How can researchers effectively investigate the cross-talk between ZDHHC18 and TGF-β signaling pathways?

The cross-talk between ZDHHC18 and TGF-β signaling represents a critical intersection in fibrotic processes. To investigate this relationship effectively:

  • Sequential stimulation experiments:

    • Pre-treatment with TGF-β1 followed by assessment of ZDHHC18 expression

    • Evaluation of ZDHHC18-dependent changes in SMAD2/3 activation

    • Analysis of how TGF-β1-induced gene expression is modulated by ZDHHC18 knockout or overexpression

  • Chromatin immunoprecipitation (ChIP) approaches:

    • ChIP-PCR can assess RREB1 binding to enhancer regions of Snai1 and Has2

    • Comparison between wild-type and ZDHHC18 knockout conditions reveals ZDHHC18-dependent effects

    • Sequential ChIP can determine co-occupancy of transcription factors at specific genomic regions

  • Co-immunoprecipitation assays:

    • Evaluation of protein-protein interactions between SMAD2/3 and RREB1

    • Assessment of how these interactions are affected by ZDHHC18 status

    • Determination of the role of HRAS palmitoylation in mediating these interactions

Research has shown that ZDHHC18 knockout attenuates TGF-β1-induced expression of fibrotic genes, including Snai1 and Has2, demonstrating the functional significance of this cross-talk .

What are the potential therapeutic implications of targeting ZDHHC18 in kidney diseases?

ZDHHC18 represents a promising therapeutic target for kidney fibrosis based on several lines of evidence:

  • ZDHHC18 expression is significantly upregulated in fibrotic kidneys from both mouse models and human CKD patients

  • Tubule-specific deletion of ZDHHC18 attenuates renal fibrosis in experimental models

  • ZDHHC18 functions at the intersection of TGF-β and RAS signaling pathways, both of which are implicated in fibrotic processes

  • The enzymatic activity of ZDHHC18 provides a potentially druggable target

Future therapeutic strategies could include:

  • Development of small molecule inhibitors specific to ZDHHC18 palmitoyltransferase activity

  • RNA interference approaches to downregulate ZDHHC18 expression

  • Gene therapy to deliver modified ZDHHC18 with altered substrate specificity

  • Combination therapies targeting both ZDHHC18 and downstream effectors

How can multi-omics approaches advance our understanding of ZDHHC18 biology?

Integrative multi-omics approaches can provide comprehensive insights into ZDHHC18 biology:

Omics ApproachApplication to ZDHHC18 ResearchExpected Insights
TranscriptomicsProfiling gene expression changes in ZDHHC18 knockout vs. wild-type conditionsIdentification of downstream regulated genes
ProteomicsGlobal analysis of protein expression and post-translational modificationsDiscovery of novel ZDHHC18 substrates
Palmitoyl-proteomicsSpecific identification of palmitoylated proteinsComprehensive substrate profiling
InteractomicsMapping ZDHHC18 protein-protein interaction networksUnderstanding regulatory complexes
GenomicsAnalysis of genetic variants in ZDHHC18Association with disease susceptibility

Integration of these datasets can reveal how ZDHHC18-mediated palmitoylation influences multiple cellular processes simultaneously and identify potential compensatory mechanisms when ZDHHC18 function is compromised.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.