Recombinant Rat Palmitoyltransferase ZDHHC2 (Zdhhc2)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

ZDHHC2 belongs to the zinc finger DHHC-type palmitoyltransferase family, which catalyzes protein S-palmitoylation by transferring palmitate from acyl-CoA to cysteine residues on substrate proteins . Key functional attributes include:

  • Subcellular Localization: Predominantly localizes to dendritic vesicles, recycling endosomes, and plasma membranes in neurons .

  • Substrate Specificity: Targets proteins like PSD-95, δ-catenin, and AKAP5, modulating synaptic strength and receptor trafficking .

  • Enzymatic Mechanism: Utilizes a "ping-pong" mechanism involving auto-acylation followed by substrate palmitoylation .

3.1. Synaptic Plasticity Studies

Recombinant ZDHHC2 is used to investigate activity-dependent palmitoylation in neurons. For example:

  • PSD-95 Regulation: ZDHHC2 dynamically palmitoylates PSD-95 during synaptic plasticity, influencing AMPA receptor clustering .

  • δ-Catenin Trafficking: Mediates δ-catenin palmitoylation to enhance AMPAR surface insertion during long-term potentiation (LTP) .

3.2. Disease Mechanisms

  • Cancer: Overexpression of ZDHHC2 in clear cell renal cell carcinoma (ccRCC) promotes sunitinib resistance by palmitoylating AGK, activating the AKT–mTOR pathway .

  • Immune Regulation: Zdhhc2 knockdown in B cells impairs germinal center differentiation, suggesting roles in adaptive immunity .

Technical Considerations

ParameterRecommendation
ReconstitutionUse deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .
Activity AssaysPair with depalmitoylating enzymes (e.g., ABHD17) to study palmitate cycling .
Inhibitors2-bromopalmitate (2-BP) blocks enzymatic activity, reversing sunitinib resistance in cancer models .

Comparative Insights

SpeciesOrthologKey Differences
HumanZDHHC2Shares 85% amino acid identity; implicated in hepatocellular carcinoma .
ZebrafishZDHHC2Conserved DHHC domain but divergent substrate specificity .

Future Directions

  • Therapeutic Targeting: Develop ZDHHC2-specific inhibitors to counteract drug resistance in cancers .

  • Structural Studies: Resolve full 3D structures to elucidate substrate-binding mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice, please inform us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc2; Srec; Palmitoyltransferase ZDHHC2; Acyltransferase ZDHHC2; Zinc finger DHHC domain-containing protein 2; DHHC-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Zdhhc2
Target Protein Sequence
MAPSGPGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRT MSGAIRYCDRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSQGDGCSFPTCLVNQD PEQPSTPAGLNSTAKNPENHQFPAKPLRESQSHLLTDSQTWTENSSNSGRCKAGMSNPAL TMENET
Uniprot No.

Target Background

Function
Palmitoyltransferase ZDHHC2 (Zdhhc2) is a recombinant rat enzyme that catalyzes the addition of palmitate to various protein substrates. This process, known as palmitoylation, plays a critical role in numerous cellular processes. ZDHHC2 exhibits broad fatty acid selectivity, capable of transferring palmitate, myristate from tetradecanoyl-CoA, and stearate from octadecanoyl-CoA onto target proteins. In the nervous system, ZDHHC2 is involved in long-term synaptic potentiation by palmitoylating AKAP5. This interaction regulates protein trafficking from dendritic recycling endosomes to the plasma membrane, contributing to structural and functional plasticity at excitatory synapses. During periods of reduced synaptic activity, ZDHHC2 mediates the palmitoylation of DLG4 within dendrites. This palmitoylation induces synaptic clustering of DLG4 and associated AMPA-type glutamate receptors. Additionally, ZDHHC2 mediates both de novo and turnover palmitoylation of RGS7BP, a shuttle for Gi/o-specific GTPase-activating proteins (GAPs). This palmitoylation promotes RGS7BP localization to the plasma membrane in response to the activation of G protein-coupled receptors. By regulating the localization of these GAPs, ZDHHC2 likely plays a role in G protein-coupled receptor signaling within neurons. ZDHHC2 may also contribute to cell adhesion by palmitoylating CD9 and CD151, thereby regulating their expression and function. It palmitoylates the endoplasmic reticulum protein CKAP4, influencing its localization to the plasma membrane. Furthermore, ZDHHC2 may palmitoylate LCK, potentially regulating its localization to the plasma membrane.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell junction, synapse, postsynaptic density. Postsynaptic recycling endosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC2 and what is its primary function?

ZDHHC2 is a palmitoyl acyltransferase (PAT) that catalyzes S-palmitoylation, a post-translational modification that involves the addition of palmitate to specific cysteine residues on target proteins. Its primary function is to regulate the subcellular localization, stability, and activity of various substrate proteins through this modification. ZDHHC2 belongs to the ZDHHC family of enzymes characterized by a conserved DHHC (Asp-His-His-Cys) motif that is essential for their catalytic activity .

How is ZDHHC2 expression regulated in normal tissues?

ZDHHC2 expression is differentially regulated across various tissues, with its expression patterns often corresponding to specific physiological needs of those tissues. In normal conditions, ZDHHC2 expression is tightly controlled through transcriptional, post-transcriptional, and post-translational mechanisms. Studies have shown that ZDHHC2 can be significantly upregulated during certain inflammatory responses, as evidenced by increased mRNA levels in psoriatic skin in mouse models . The regulatory elements controlling ZDHHC2 expression in different contexts remain an active area of investigation.

What are the key substrates of ZDHHC2?

One key substrate of ZDHHC2 is acylglycerol kinase (AGK), which plays significant roles in cellular signaling pathways. ZDHHC2 catalyzes AGK S-palmitoylation specifically at the cysteine-72 (C72) residue, which is highly conserved across different species . This palmitoylation is critical for AGK's plasma membrane localization and subsequent activation of downstream signaling cascades. Other identified substrates include various proteins involved in signal transduction and membrane trafficking, though the complete substrate profile of ZDHHC2 continues to be expanded through ongoing research.

What experimental techniques are commonly used to measure ZDHHC2 enzyme activity?

Several methodologies are employed to assess ZDHHC2 enzymatic activity:

  • Acyl-biotinyl exchange (ABE) technique - This approach involves replacing palmitoyl modifications with biotin, followed by streptavidin blotting to detect palmitoylated proteins. This technique has successfully demonstrated AGK palmitoylation in renal clear cell carcinoma cells .

  • Click chemistry-based detection - Using biotin alkyne to label palmitoylated proteins via click-iT reaction, which can then be visualized through streptavidin blotting .

  • In vitro palmitoylation assays - These assays utilize palmitoyl alkyne-CoA as a palmitate donor to directly assess the enzymatic activity of wild-type ZDHHC2 compared to catalytically inactive mutants (such as ZDHHC2-C129A) .

  • Site-directed mutagenesis - Converting potential palmitoylation sites from cysteine (C) to serine (S) or alanine (A) can help identify specific residues required for substrate palmitoylation .

How does ZDHHC2-mediated palmitoylation regulate membrane localization of target proteins?

ZDHHC2-mediated palmitoylation significantly influences the subcellular localization of its target proteins, particularly their association with the plasma membrane. The addition of palmitate increases protein hydrophobicity, thereby facilitating membrane anchoring. For instance, ZDHHC2 catalyzes the S-palmitoylation of AGK at cysteine-72, which is essential for AGK's plasma membrane localization .

Research has demonstrated that silencing ZDHHC2 significantly reduces AGK plasma membrane localization in multiple cell lines, including 786-O and A498 cells. Conversely, reintroduction of wild-type ZDHHC2, but not the catalytically inactive C129A mutant, restores AGK's plasma membrane localization . Subcellular fractionation experiments combined with immunoblotting analysis confirm this relationship between palmitoylation status and membrane distribution.

Furthermore, mutation of the palmitoylation site on AGK (C72S) significantly decreases its plasma membrane localization compared to wild-type AGK, affirming that ZDHHC2-mediated palmitoylation is a critical determinant of protein compartmentalization within the cell .

What are the structural determinants of ZDHHC2 substrate specificity?

The substrate specificity of ZDHHC2 is determined by several structural features:

  • Catalytic DHHC domain - The conserved DHHC motif is essential for enzymatic activity, as evidenced by the complete loss of palmitoylation activity in ZDHHC2-C129A mutants .

  • Substrate recognition motifs - ZDHHC2 recognizes specific amino acid sequences surrounding the target cysteine residues. For AGK, cysteine-72 has been identified as the primary palmitoylation site .

  • Protein-protein interaction domains - These facilitate specific binding between ZDHHC2 and its substrate proteins before the palmitoylation reaction occurs.

  • Structural conformation - The three-dimensional arrangement of both ZDHHC2 and its substrates plays a crucial role in determining successful enzyme-substrate interactions.

Understanding these determinants is essential for predicting novel ZDHHC2 substrates and designing specific inhibitors targeting ZDHHC2 enzymatic activity for therapeutic applications.

How does ZDHHC2 palmitoylation activity differ from other ZDHHC family members?

ZDHHC2 exhibits distinct characteristics compared to other ZDHHC family members:

  • Substrate selectivity - ZDHHC2 shows preferential activity toward specific substrates like AGK. In CRISPR-mediated knockout studies of multiple ZDHHC proteins, only ZDHHC2 knockout abolished AGK palmitoylation, demonstrating its non-redundant role in this specific modification .

  • Subcellular localization - ZDHHC2 localizes to specific cellular compartments, which influences its access to certain substrates compared to other ZDHHC proteins.

  • Regulatory mechanisms - ZDHHC2 activity is regulated through distinct mechanisms that may differ from those controlling other ZDHHC family members.

  • Pathological significance - ZDHHC2 upregulation has been specifically linked to sunitinib resistance in clear cell renal cell carcinoma and psoriasis pathology, suggesting unique pathophysiological roles compared to other family members .

Further comparative studies across the ZDHHC family are needed to fully characterize the unique enzymatic properties of ZDHHC2.

What role does ZDHHC2 play in cancer progression and drug resistance?

ZDHHC2 has been identified as a critical mediator of tyrosine kinase inhibitor (TKI) resistance in cancer, particularly in clear cell renal cell carcinoma (ccRCC). Research has demonstrated that ZDHHC2 is abnormally upregulated in sunitinib-resistant ccRCC cell lines and tissue samples .

Mechanistically, ZDHHC2 confers sunitinib resistance through:

  • AGK palmitoylation - ZDHHC2 catalyzes the S-palmitoylation of AGK at cysteine-72, promoting its plasma membrane localization .

  • PI3K-AKT-mTOR pathway activation - Palmitoylated AGK activates the PI3K-AKT-mTOR signaling axis, a known mediator of TKI resistance. This is evidenced by increased phosphorylation of AKT (at S473 and T308) and S6K1 (at T389) upon ZDHHC2 overexpression .

  • Regulation of cell proliferation and EMT - ZDHHC2 modulates cellular processes critical for tumor progression, including proliferation and epithelial-mesenchymal transition .

Knockout studies have shown that ZDHHC2 depletion significantly increases cancer cell sensitivity to sunitinib, enhancing apoptosis after treatment. Conversely, overexpression of wild-type ZDHHC2, but not the catalytically inactive C129A mutant, reduces sunitinib-induced apoptosis, confirming that ZDHHC2's palmitoylation activity is central to drug resistance mechanisms .

How does ZDHHC2 contribute to inflammatory skin disorders like psoriasis?

ZDHHC2 has emerged as a significant player in inflammatory skin conditions, particularly psoriasis. Studies have shown that Zdhhc2 mRNA levels are significantly elevated in psoriatic skin in imiquimod-induced psoriasis mouse models .

The contribution of ZDHHC2 to psoriasis pathology involves multiple mechanisms:

  • Regulation of inflammatory cytokine production - Zdhhc2 deficiency dramatically reduces the expression of pro-inflammatory cytokines, particularly IFN-α, in inflamed skin .

  • Modulation of plasmacytoid dendritic cells (pDCs) - ZDHHC2 appears to be essential for the accumulation and activation of pDCs in the skin, which are key cellular mediators of psoriasis pathogenesis .

  • Influence on IRF7 activity - Loss of zDHHC2 in human pDC cell lines (CAL-1) dampens IRF7 activity, a critical transcription factor for type I interferon production .

CRISPR/Cas9-mediated knockout of Zdhhc2 in mice significantly inhibits the pathological grade of psoriasis and reduces inflammatory cell infiltration in the skin, suggesting that ZDHHC2 could be a potential therapeutic target for inflammatory skin disorders .

What signaling pathways are regulated by ZDHHC2-mediated protein palmitoylation?

ZDHHC2 influences multiple signaling cascades through its palmitoylation activity:

  • PI3K-AKT-mTOR pathway - Transcriptome analysis of ZDHHC2-silenced cells reveals significant modulation of this pathway. ZDHHC2-mediated AGK palmitoylation activates AKT (increased phosphorylation at S473 and T308) and downstream mTOR signaling (enhanced S6K1-T389 phosphorylation) .

  • HIF1 signaling - KEGG enrichment analysis and gene set enrichment analysis (GSEA) of RNA-seq data indicate that ZDHHC2 silencing modulates the HIF1 pathway in 786-O cells .

  • PD-L1 expression and PD-1 checkpoint pathway - ZDHHC2 appears to influence this important immunoregulatory axis, as revealed by pathway analysis .

  • FOXO signaling pathway - GSEA data suggests ZDHHC2 involvement in regulating FOXO-mediated transcriptional programs .

  • Type I interferon signaling - In inflammatory contexts, ZDHHC2 regulates IRF7 activity, which controls type I interferon production, particularly IFN-α .

These diverse pathway interactions highlight ZDHHC2's complex role as a regulatory node connecting multiple signaling networks in both cancer and inflammatory conditions.

What genetic approaches are effective for studying ZDHHC2 function in vivo?

Several genetic approaches have proven effective for investigating ZDHHC2 function:

  • CRISPR/Cas9-mediated knockout - This approach has been successfully employed to generate ZDHHC2-deficient mice and cell lines. For example, two sgRNAs targeting the ZDHHC2 gene were utilized to create knockout CAL-1 cell lines . In another study, CRISPR/Cas9 was used to knock out 24 different PATs, including ZDHHC2, in 786-O cells to assess their roles in sunitinib sensitivity .

  • siRNA-mediated knockdown - Transient silencing of ZDHHC2 expression using specific siRNAs has been employed for transcriptome analysis to identify ZDHHC2-regulated pathways .

  • Overexpression studies - Introducing wild-type or mutant ZDHHC2 (e.g., catalytically inactive C129A) constructs into cells provides insights into the requirement for ZDHHC2's enzymatic activity in various cellular functions .

  • Rescue experiments - Reintroducing ZDHHC2 into knockout cells helps confirm the specificity of observed phenotypes and rule out off-target effects .

  • Generation of point mutants - Creating specific mutations in ZDHHC2 (e.g., C129A) or its substrates (e.g., AGK-C72S) enables detailed structure-function analyses .

These genetic approaches, combined with appropriate disease models, have revealed ZDHHC2's roles in cancer drug resistance and inflammatory skin disorders.

What biochemical assays are most sensitive for detecting ZDHHC2-mediated protein palmitoylation?

Several biochemical techniques have been optimized for detecting ZDHHC2-mediated palmitoylation:

  • Acyl-Biotinyl Exchange (ABE) Technique:

    • This method involves three key steps: blocking free thiols with N-ethylmaleimide, cleaving thioester bonds with hydroxylamine, and biotinylating newly exposed thiols.

    • Detection is achieved through streptavidin blotting, allowing visualization of palmitoylated proteins.

    • This technique successfully demonstrated AGK palmitoylation in renal cell carcinoma cell lines .

  • Click Chemistry-Based Detection:

    • Metabolic labeling with alkyne-modified palmitate analogs followed by copper-catalyzed azide-alkyne cycloaddition (click reaction) with biotin-azide.

    • This approach showed that approximately 20% of AGK is palmitoylated in 786-O and A498 cells .

  • In Vitro Palmitoylation Assays:

    • Direct assessment of enzymatic activity using purified components with palmitoyl-CoA or palmitoyl alkyne-CoA as palmitate donors.

    • This method confirmed that ZDHHC2 directly palmitoylates AGK at cysteine-72 and that this activity requires ZDHHC2's catalytic cysteine (C129) .

  • 2-Bromopalmitate (2-BP) Treatment:

    • This non-selective palmitoylation inhibitor can be used to verify palmitoylation-dependent phenotypes.

    • Studies showed that 2-BP treatment attenuated the sunitinib resistance-promoting effect induced by ZDHHC2 overexpression .

  • Subcellular Fractionation:

    • This approach isolates different cellular compartments to track palmitoylation-dependent protein localization.

    • It demonstrated that ZDHHC2-mediated AGK palmitoylation promotes its plasma membrane localization .

The combination of these complementary techniques provides robust validation of ZDHHC2-mediated palmitoylation events.

How can researchers effectively identify novel ZDHHC2 substrates?

Identifying novel ZDHHC2 substrates requires a multifaceted approach:

  • Palmitoyl-Proteomics:

    • Combine ABE or click chemistry with mass spectrometry to identify proteins with altered palmitoylation status in ZDHHC2-manipulated systems.

    • Compare palmitoylated proteins in wild-type versus ZDHHC2 knockout cells to identify differentially palmitoylated candidates.

  • Bioinformatic Prediction:

    • Utilize computational tools like CSS-Palm 4.0 to predict potential palmitoylation sites based on consensus motifs.

    • This approach successfully predicted the C72 palmitoylation site on AGK, which was subsequently confirmed experimentally .

  • Protein-Protein Interaction Studies:

    • Immunoprecipitation followed by mass spectrometry can identify proteins that physically interact with ZDHHC2.

    • These interacting proteins are potential palmitoylation substrates.

  • Systematic Mutagenesis:

    • For candidate substrates, create cysteine-to-serine (or cysteine-to-alanine) mutations at predicted palmitoylation sites.

    • Test these mutants in palmitoylation assays to confirm specific modification sites .

  • Functional Validation:

    • Assess whether candidate substrates show altered localization, activity, or stability in ZDHHC2-depleted cells.

    • Determine if palmitoylation-deficient mutants phenocopy ZDHHC2 depletion effects.

  • In Vitro Reconstitution:

    • Test direct palmitoylation of purified candidate substrates by recombinant ZDHHC2 in a cell-free system .

This integrated approach can effectively expand the known repertoire of ZDHHC2 substrates beyond the currently identified proteins like AGK.

What are the most promising therapeutic strategies targeting ZDHHC2?

Several therapeutic approaches targeting ZDHHC2 show promise for treating conditions like drug-resistant cancer and inflammatory disorders:

  • Specific ZDHHC2 Inhibitors:

    • Developing selective small-molecule inhibitors targeting ZDHHC2's catalytic activity represents a promising approach.

    • Current research suggests that such inhibitors could enhance the efficacy of tyrosine kinase inhibitors like sunitinib in clear cell renal cell carcinoma .

  • Combination Therapies:

    • Pairing ZDHHC2 inhibition with mTOR inhibitors may overcome resistance mechanisms in cancer treatment.

    • Clinical trials have demonstrated that sequential use of multitargeted TKIs and mTOR inhibitors is effective for advanced ccRCC patients, and ZDHHC2 inhibition could further enhance these approaches .

  • Disruption of ZDHHC2-Substrate Interactions:

    • Peptide-based or small-molecule compounds that interfere with ZDHHC2's binding to specific substrates could provide targeted intervention without completely blocking all ZDHHC2 functions.

  • Targeted Degradation:

    • Proteolysis-targeting chimeras (PROTACs) or other degrader approaches could selectively eliminate ZDHHC2 protein in disease contexts.

  • Nanoparticle-Delivered siRNA/shRNA:

    • Targeted delivery of RNA interference molecules to silence ZDHHC2 expression in specific tissues represents another potential therapeutic approach.

The identification of ZDHHC2 as a critical mediator in both cancer drug resistance and inflammatory skin disorders suggests that targeting its activity could have broad therapeutic applications .

How does ZDHHC2-mediated palmitoylation interact with other post-translational modifications?

The interplay between ZDHHC2-mediated palmitoylation and other post-translational modifications (PTMs) represents an important frontier in understanding cellular signaling networks:

  • Phosphorylation-Palmitoylation Crosstalk:

    • Palmitoylation by ZDHHC2 may influence the phosphorylation status of substrate proteins and vice versa.

    • For instance, AGK palmitoylation leads to increased phosphorylation of AKT at S473 and T308 sites, suggesting that palmitoylation can modulate the phosphorylation of downstream signaling components .

  • Ubiquitination and Protein Stability:

    • ZDHHC2-mediated palmitoylation might protect proteins from ubiquitin-mediated degradation by altering their subcellular localization or conformation.

  • Glycosylation Interactions:

    • For membrane proteins, the relationship between palmitoylation and glycosylation could influence protein trafficking and surface expression.

  • Acetylation and Methylation:

    • These modifications often regulate protein-protein interactions and enzyme activity, potentially in conjunction with palmitoylation.

  • Reversible Nature of Palmitoylation:

    • Unlike many other PTMs, palmitoylation is reversible through depalmitoylation by acyl protein thioesterases (APTs), creating a dynamic regulatory mechanism that can respond to other modification events.

Understanding these interconnected modification networks will provide deeper insights into how ZDHHC2 functions within the broader cellular signaling landscape.

What role might ZDHHC2 play in other inflammatory or immune-related diseases?

Given ZDHHC2's established roles in psoriasis and cancer, its potential involvement in other inflammatory and immune-related conditions warrants investigation:

  • Autoimmune Disorders:

    • ZDHHC2's regulation of interferon production through IRF7 activity suggests potential roles in systemic lupus erythematosus, rheumatoid arthritis, and other autoimmune conditions characterized by type I interferon signatures .

  • Inflammatory Bowel Disease:

    • The involvement of ZDHHC2 in inflammatory pathways might extend to intestinal inflammation, where altered cytokine production contributes to disease pathogenesis.

  • Respiratory Inflammatory Conditions:

    • Conditions like asthma and chronic obstructive pulmonary disease, which involve immune cell infiltration and cytokine dysregulation, could potentially be influenced by ZDHHC2 activity.

  • Neuroinflammatory Disorders:

    • The blood-brain barrier's integrity and neuroinflammatory processes might be regulated by ZDHHC2-mediated palmitoylation of key proteins involved in these processes.

  • Infectious Disease Responses:

    • ZDHHC2's role in plasmacytoid dendritic cell function suggests it may influence antiviral immune responses beyond its known effects in imiquimod-induced inflammation .

Research in these areas could expand the therapeutic relevance of ZDHHC2 inhibition strategies beyond current applications and provide new insights into disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.