Recombinant Rat Palmitoyltransferase ZDHHC7 (Zdhhc7)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

ZDHHC7 exhibits protein-cysteine S-palmitoyltransferase activity, enabling it to modify substrates critical for cellular signaling, membrane localization, and protein stability . Key substrates include:

SubstrateFunctional RoleReference
NLRP3Promotes inflammasome activation by palmitoylating Cys126, enabling ASC recruitment
SNAP25Regulates synaptic vesicle fusion in neurons
ESR1/PGR/ARFacilitates plasma membrane localization of sex steroid hormone receptors
SCRIBControls plasma membrane localization for polarity signaling

Role in Disease Pathways

  • Neurological Disorders: Zdhhc7 regulates palmitoylation of BACE1 (implicated in Alzheimer’s disease) and AMPA receptors (linked to epilepsy) .

  • Inflammatory Diseases: ZDHHC7-mediated NLRP3 palmitoylation drives inflammasome activation in endotoxic shock and peritonitis .

  • Cancer: Palmitoylation of Bip proteins by ZDHHC9 (a homolog) stabilizes oncogenic signaling in bladder cancer .

Applications in Research

Recombinant Zdhhc7 is pivotal for:

ApplicationExperimental UseReference
Enzyme Activity AssaysQuantifying S-acylation kinetics using radiolabeled palmitate or click chemistry
Structural StudiesMapping transmembrane domain interactions via domain-swapping mutants
Disease ModelingInvestigating NLRP3 inflammasome activation in macrophages
Substrate IdentificationHigh-throughput screening for novel Zdhhc7 targets

Challenges and Considerations

  • Specificity: Zdhhc7 exhibits broad substrate selectivity, necessitating rigorous controls to distinguish its activity from other ZDHHC isoforms .

  • Stability: Recombinant Zdhhc7 requires storage at -80°C in glycerol-containing buffers to prevent aggregation .

  • Regulatory Complexity: Auto-palmitoylation of ZDHHC enzymes (e.g., ZDHHC5/ZDHHC20 cascades) complicates functional studies .

Future Directions

Ongoing research aims to:

  1. Develop isoform-specific inhibitors for Zdhhc7 to treat inflammatory and neurological disorders .

  2. Elucidate the structural basis of fatty acid selectivity using cryo-EM .

  3. Expand palmitoyl-proteomics datasets to identify novel Zdhhc7 substrates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may arise. Please indicate any preferred format during order placement, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your product.
Synonyms
Zdhhc7; Serz; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; Sertoli cell gene with a zinc finger domain protein; Zinc finger DHHC domain-containing protein 7; DHHC7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Zdhhc7
Target Protein Sequence
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVY ADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM YIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTR KGGPEFSV
Uniprot No.

Target Background

Function
ZDHHC7, a Golgi-localized palmitoyltransferase, plays a critical role in various biological processes by catalyzing the addition of palmitate to diverse protein substrates. Exhibiting no stringent fatty acid selectivity, it can also transfer myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA to target proteins. ZDHHC7 palmitoylates sex steroid hormone receptors, including ESR1, PGR, and AR, regulating their plasma membrane targeting and function in rapid intracellular signaling upon sex hormone binding. It also palmitoylates GNAQ, a heterotrimeric G protein, controlling its dynamic localization at the plasma membrane and influencing GNAQ-dependent G protein-coupled receptor signaling pathways. Additionally, ZDHHC7 contributes to ligand-induced cell death by regulating the FAS signaling pathway through palmitoylation and stabilization of the receptor at the plasma membrane. In epithelial cells, ZDHHC7 palmitoylates SCRIB, regulating its plasma membrane localization and indirectly influencing cell polarity and differentiation. It further promotes JAM3 expression at tight junctions and regulates its function in cell migration by palmitoylating it. ZDHHC7 palmitoylates the glucose transporter GLUT4/SLC2A4, controlling the insulin-dependent translocation of GLUT4 to the plasma membrane. In the brain, ZDHHC7 may also palmitoylate SNAP25 and DLG4/PSD95. It could also palmitoylate DNAJC5, regulating its localization to the Golgi membrane, and may palmitoylate NCDN. ZDHHC7 potentially plays a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Present in Sertoli cells (at protein level).

Q&A

What is ZDHHC7 and what are its main biochemical functions?

ZDHHC7 (zinc finger, DHHC-type containing 7) is a palmitoyltransferase enzyme with broad substrate specificity. It possesses several key biochemical functions including palmitoyltransferase activity, protein-cysteine S-palmitoyltransferase activity, and zinc ion binding capabilities . The enzyme catalyzes the addition of palmitate groups to specific cysteine residues in target proteins via thioester linkages, a post-translational modification critical for protein localization and function. ZDHHC7 plays significant roles in palmitoylating various substrates including JAM3, SNAP25, and DLG4/PSD95, as well as sex steroid hormone receptors such as ESR1, PGR, and AR . This palmitoylation activity is crucial for regulating the targeting of these receptors to plasma membranes and their function in rapid intracellular signaling upon binding of sex hormones.

How does ZDHHC7 differ from other members of the ZDHHC family?

ZDHHC7 belongs to the 23-member ZDHHC family of palmitoyltransferases but has distinct characteristics that differentiate it from other family members. While all ZDHHC enzymes share a conserved DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) catalytic motif, ZDHHC7 exhibits a unique fatty acid selectivity profile compared to close homologs like ZDHHC3 . Notably, ZDHHC7 demonstrates enhanced ability to incorporate C18:0 fatty acid chains compared to ZDHHC3 . This selectivity difference has been mapped to specific residues in the transmembrane domain 3, with the presence of serine at position 182 in ZDHHC7 (compared to isoleucine in ZDHHC3) playing a particularly important role in determining this substrate preference . Understanding these molecular differences provides crucial insights for researchers designing experiments targeting specific ZDHHC isoforms.

What are the recommended methods for expressing and purifying recombinant rat ZDHHC7?

The expression and purification of functional recombinant rat ZDHHC7 requires careful consideration of its multi-transmembrane domain structure. For optimal expression, mammalian cell systems such as HEK293 cells are often preferred over bacterial systems due to the enzyme's requirement for proper membrane insertion and post-translational modifications . When designing expression constructs, researchers should consider the following methodological approach:

  • Generate a construct with an appropriate affinity tag (His, Fc, or Avi tags) positioned to avoid interference with the catalytic DHHC domain .

  • Utilize a strong mammalian promoter system (CMV or EF1α) for optimal expression levels.

  • Include the complete coding sequence, as truncated versions may lack proper folding or activity.

  • For purification, employ detergent-based membrane protein extraction methods using mild detergents such as dodecylphosphocholine (DPC) .

  • Implement rapid processing protocols to preserve thioester linkages and prevent deacylation of the enzyme during purification .

This approach facilitates the isolation of properly folded, functional enzyme suitable for subsequent activity assays and substrate identification studies.

What assays can be used to measure the palmitoyltransferase activity of recombinant ZDHHC7?

Several complementary assays can be employed to assess the palmitoyltransferase activity of recombinant ZDHHC7, each with specific advantages depending on the research question:

  • Autoacylation assays: These measure the formation of the enzyme-acyl intermediate (palmitoyl-ZDHHC7), which represents the first step of the two-step reaction mechanism . This approach monitors the enzyme's ability to transfer the palmitate from palmitoyl-CoA to itself.

  • Substrate palmitoylation assays: These assays measure the transfer of palmitate to specific protein substrates. They can be performed using:

    • Radiolabeled palmitate ([³H]palmitate)

    • Click chemistry with alkyne-palmitate analogs followed by azide-fluorophore conjugation

    • Acyl-biotin exchange (ABE) methods for detecting palmitoylated proteins

  • Hydroxylamine sensitivity tests: Since palmitoylation creates thioester linkages, treatment with hydroxylamine (1M, pH 7) should abolish the signal, confirming the nature of the modification .

For quantitative analysis, researchers should consider including control samples (empty vector or catalytically inactive C157S mutant) to account for background palmitoylation by endogenous enzymes .

How is substrate specificity determined for ZDHHC7, and what are its known substrates?

ZDHHC7 exhibits broad but defined substrate specificity that can be characterized through systematic approaches. To determine substrate specificity, researchers should consider:

  • Proteomic identification approaches: Using bioorthogonal labeling strategies with alkyne-fatty acid analogs followed by click chemistry and mass spectrometry . This approach enables unbiased identification of ZDHHC7 substrates.

  • Candidate substrate validation: Testing potential substrates identified from proteomic screens through in vitro and cellular palmitoylation assays, with comparison to other ZDHHC enzymes to determine specificity.

Known substrates of ZDHHC7 include:

  • Junction adhesion molecule 3 (JAM3)

  • Synaptosomal-associated protein 25 (SNAP25)

  • Discs large homolog 4 (DLG4/PSD95)

  • Sex steroid hormone receptors (ESR1, PGR, AR)

For rigorous substrate identification, researchers should implement controls with catalytically inactive mutants and employ complementary approaches such as proximity labeling techniques to validate direct enzyme-substrate interactions.

What molecular mechanisms determine fatty acid chain selectivity in ZDHHC7?

The fatty acid chain selectivity of ZDHHC7 is determined by specific structural elements within its transmembrane domains, particularly transmembrane domain 3 (TMD3). Domain swapping experiments between ZDHHC3 and ZDHHC7 revealed that:

  • Replacing transmembrane domain 3 of ZDHHC3 with the corresponding domain from ZDHHC7 was sufficient to alter the fatty acid selectivity profile, particularly for C18:0 incorporation .

  • Specifically, the presence of serine at position 182 in ZDHHC7 (corresponding to isoleucine in ZDHHC3) plays a critical role in determining C18:0 selectivity .

  • The fatty acid binding cavity formed by the transmembrane helices creates a defined space that accommodates fatty acids of specific lengths and structures .

These findings highlight how subtle amino acid differences within transmembrane regions can significantly impact substrate selectivity, providing researchers with molecular targets for engineering ZDHHC enzymes with modified selectivity profiles. For experimental investigation of these mechanisms, site-directed mutagenesis combined with activity assays using fatty acid analogs of varying chain lengths offers a powerful approach.

How can orthogonal enzyme-substrate pairs be designed for studying ZDHHC7-specific palmitoylation?

Designing orthogonal enzyme-substrate pairs represents a sophisticated approach for delineating ZDHHC7-specific palmitoylation events in complex cellular environments. This methodology involves creating engineered ZDHHC7 variants that can exclusively utilize synthetic fatty acyl-CoA analogs not recognized by wild-type enzymes . The procedure involves:

  • Structural analysis: Examining the fatty acyl-binding cavity of ZDHHC7 to identify residues that can be mutated to accommodate bulky synthetic analogs.

  • Enzyme engineering: Creating point mutations in ZDHHC7 transmembrane domains, particularly positions that line the fatty acid binding pocket. For example, mutations analogous to the Y181A (DHHC20-YA) or C182F (DHHC20-CF) in ZDHHC20 might create effective orthogonal variants .

  • Synthetic analog design: Developing palmitate analogs with modifications that prevent utilization by wild-type enzymes but allow processing by the engineered ZDHHC7. Analogs containing bulky aromatic substituents at the termini of the acyl chain have shown success .

  • Validation testing: Confirming orthogonality through autoacylation assays that demonstrate selective incorporation of the synthetic analog by the engineered ZDHHC7 variant but not the wild-type enzyme.

This approach enables specific labeling and identification of ZDHHC7 substrates without interference from other endogenous ZDHHC enzymes, providing a powerful tool for elucidating the physiological roles of ZDHHC7-mediated palmitoylation.

What strategies can be employed to identify novel substrates of ZDHHC7 in specific tissues or disease states?

Identifying novel ZDHHC7 substrates in tissue- or disease-specific contexts requires sophisticated strategies that combine genetic, proteomic, and biochemical approaches:

  • Tissue-specific expression systems: Employ cell lines or primary cultures that model the tissue of interest, coupled with controlled expression of wild-type and catalytically inactive ZDHHC7.

  • Bioorthogonal labeling with clickable palmitate analogs: Use metabolic labeling with alkyne-palmitate followed by click chemistry and proteomic analysis to identify palmitoylated proteins . Compare proteomes from systems expressing active versus inactive ZDHHC7.

  • Engineered enzyme-substrate pairs: Utilize the orthogonal enzyme-substrate strategy with engineered ZDHHC7 mutants that accept modified palmitate analogs not utilized by wild-type enzymes . This allows specific identification of ZDHHC7 substrates even in complex environments.

  • Optimized sample preparation workflow:

    • Use appropriate detergents like dodecylphosphocholine (DPC) to improve solubility of palmitoylated proteins

    • Process samples rapidly to prevent deacylation

    • Implement thorough washing steps during enrichment to decrease sample complexity

    • Filter identified proteins using criteria such as minimum sequence coverage (>5%) to increase confidence

  • Validation strategies: Confirm candidate substrates through multiple approaches including in vitro palmitoylation assays, mutagenesis of predicted palmitoylation sites, and functional studies examining the impact of ZDHHC7 inhibition or deletion on substrate localization and function.

This multi-faceted approach has successfully identified novel substrates, including previously unreported palmitoylated protein families involved in host restriction against pathogenic viruses, including SARS-CoV-2 .

How does rat ZDHHC7 compare structurally and functionally to human and mouse orthologs?

Rat ZDHHC7 shares significant structural and functional homology with its human and mouse orthologs, making it a valuable model for translational research. Key comparative aspects include:

  • Sequence conservation: The human ZDHHC7 control fragment (amino acids 114-173) shows 52% sequence identity with both mouse and rat orthologs , indicating moderate conservation in certain domains. The catalytic DHHC-CRD domain shows higher conservation across species.

  • Transmembrane topology: All three orthologs maintain the characteristic four-transmembrane domain structure with cytosolic N and C termini and a central intracellular loop containing the catalytic DHHC-CRD (approximately 51 amino acids) .

  • Substrate recognition: Conservation in substrate specificity appears high across species, with human, rat, and mouse ZDHHC7 all capable of palmitoylating key substrates including SNAP25 and sex hormone receptors .

  • Species-specific variations: Interestingly, zebrafish (Danio rerio) ZDHHC7 contains an isoleucine residue at position 182 rather than the serine found in mammalian orthologs . This amino acid difference corresponds to a position known to influence fatty acid selectivity, suggesting potential evolutionary adaptations in substrate preference.

When designing experiments using recombinant rat ZDHHC7 with the intention of translating findings to human contexts, researchers should be aware of these similarities and differences. Cross-species validation experiments may be necessary to confirm that observed enzymatic properties are conserved when translating from rodent to human systems.

What is known about the evolutionary relationships between ZDHHC7 and other palmitoyltransferases?

ZDHHC7 belongs to the ZDHHC family of palmitoyltransferases that has expanded throughout eukaryotic evolution. Analysis of evolutionary relationships reveals:

  • Family expansion: The ZDHHC family has expanded to 23 members in humans and other mammals, with ZDHHC7 representing one branch in this diversification .

  • Functional conservation: The two-step reaction mechanism involving autoacylation followed by transfer to substrate appears conserved across the ZDHHC family, from yeast enzymes like Erf2 to mammalian homologs including ZDHHC7 .

  • Structural homology: ZDHHC7 shares high structural similarity with ZDHHC3, enabling successful domain swapping experiments between these isoforms. This suggests recent evolutionary divergence and specialization .

  • Transmembrane domain evolution: Variations in transmembrane domains, particularly TMD3, appear to have been selected for during evolution, potentially reflecting adaptation to different substrate profiles or cellular localization patterns .

  • Conservation across vertebrates: Comparative analysis shows maintenance of key structural elements in ZDHHC7 across vertebrate species, though with notable variations in specific residues such as position 182 (serine in mammals versus isoleucine in zebrafish) .

Understanding these evolutionary relationships provides context for interpreting experimental results and can guide the development of isoform-specific modulators of ZDHHC activity. The selective pressures that have maintained ZDHHC7 as a distinct enzyme suggest it performs specialized functions that may be particularly relevant to mammalian physiology.

What are common challenges when working with recombinant ZDHHC7 and how can they be addressed?

Working with recombinant ZDHHC7 presents several technical challenges due to its multi-transmembrane structure and the labile nature of the thioester linkages involved in palmitoylation. Common challenges and solutions include:

  • Poor expression levels:

    • Problem: ZDHHC7 may express poorly due to toxicity or improper membrane insertion.

    • Solution: Optimize expression conditions by using inducible expression systems, lowering induction temperature (28-30°C), and considering specialized host cells designed for membrane protein expression .

  • Protein aggregation during purification:

    • Problem: ZDHHC7 may aggregate during extraction from membranes.

    • Solution: Use appropriate detergents such as dodecylphosphocholine (DPC) that maintain the native conformation of membrane proteins . Screen different detergent types and concentrations to identify optimal conditions.

  • Deacylation during sample processing:

    • Problem: The thioester linkage in auto-palmitoylated ZDHHC7 is labile.

    • Solution: Process samples rapidly (within 2 days) and minimize refreezing to protect the thioester bonds . Consider including palmitoylation inhibitors in buffers when analyzing palmitoylated substrates.

  • Non-specific enrichment in substrate identification studies:

    • Problem: Excessive sample complexity can lead to false positives.

    • Solution: Increase the number of washing steps during enrichment procedures, and implement filtering criteria such as minimum sequence coverage thresholds (>5%) to increase confidence in identified substrates .

  • Inconsistent activity measurements:

    • Problem: Variability in assay results due to the two-step reaction mechanism.

    • Solution: Design experiments to separately measure autoacylation and transfer steps, and ensure consistent reaction conditions including detergent concentration, which can significantly affect enzyme activity.

Implementing these solutions can substantially improve experimental reproducibility and data quality when working with recombinant ZDHHC7.

How can researchers differentiate between direct and indirect substrates of ZDHHC7?

Differentiating between direct substrates (proteins directly palmitoylated by ZDHHC7) and indirect substrates (proteins whose palmitoylation changes due to downstream effects) is crucial for accurate characterization of ZDHHC7 function. Recommended methodological approaches include:

  • In vitro palmitoylation assays:

    • Purify candidate substrates and test direct palmitoylation by ZDHHC7 in reconstituted systems.

    • Include negative controls (catalytically inactive ZDHHC7) and positive controls (known substrates like SNAP25) .

  • Orthogonal enzyme-substrate methodology:

    • Employ engineered ZDHHC7 variants that utilize synthetic palmitoyl-CoA analogs to specifically label direct substrates in cellular contexts .

    • This approach minimizes false positives from endogenous enzyme activity.

  • Proximity-based approaches:

    • Implement BioID or APEX2 proximity labeling fused to ZDHHC7 to identify proteins that physically interact with the enzyme.

    • Cross-reference proximity data with palmitoylation data to identify direct substrates.

  • Kinetic analysis:

    • Examine the time course of substrate palmitoylation following ZDHHC7 induction or inhibition.

    • Direct substrates typically show more rapid palmitoylation changes than indirect substrates.

  • Substrate motif analysis:

    • Examine candidate substrates for sequence motifs compatible with ZDHHC7 recognition.

    • Validate motif importance through site-directed mutagenesis of predicted palmitoylation sites.

By combining multiple lines of evidence from these complementary approaches, researchers can establish stronger confidence in the classification of ZDHHC7 substrates as direct or indirect.

What are the implications of ZDHHC7 in disease models and potential therapeutic applications?

ZDHHC7's involvement in regulating key cellular processes suggests important implications for disease mechanisms and therapeutic development:

  • Endocrine and reproductive disorders:

    • ZDHHC7 palmitoylates sex steroid hormone receptors (ESR1, PGR, AR), regulating their plasma membrane targeting and rapid signaling functions .

    • It also plays a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells .

    • These functions suggest potential involvement in hormone-responsive conditions including reproductive disorders and certain hormone-dependent cancers.

  • Neurological disorders:

    • ZDHHC7 palmitoylates neuronal proteins including SNAP25 and DLG4/PSD95 , which are critical for synaptic function.

    • Dysregulation of protein palmitoylation has been implicated in various neurological conditions, suggesting ZDHHC7 as a potential therapeutic target.

  • Viral infections:

    • Recent research has discovered ZDHHC7's role in palmitoylating a family of host restriction factors against pathogenic viruses, including SARS-CoV-2 .

    • Modulating ZDHHC7 activity could potentially enhance innate immune responses against viral infections.

Therapeutic approaches targeting ZDHHC7 could include:

  • Development of selective inhibitors or activators based on structural insights into the enzyme's transmembrane domains and fatty acid binding cavity

  • Gene therapy approaches to modulate ZDHHC7 expression in specific tissues

  • Substrate-specific intervention strategies that target the interaction between ZDHHC7 and specific pathologically relevant substrates

As research progresses, a clearer understanding of tissue-specific roles and substrate profiles will be essential for developing targeted interventions with minimal off-target effects.

How might advanced technologies like cryo-EM and AI-based protein structure prediction enhance our understanding of ZDHHC7 function?

Emerging technologies are poised to revolutionize our understanding of ZDHHC7 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Enables visualization of membrane proteins in near-native environments without crystallization.

    • Applications for ZDHHC7: Could reveal the complete three-dimensional structure of ZDHHC7 embedded in membranes, including the arrangement of transmembrane helices that form the fatty acid binding cavity.

    • Experimental approach: Reconstitute purified ZDHHC7 in nanodiscs or other membrane mimetics, followed by cryo-EM analysis to determine structure at near-atomic resolution.

    • Impact: Would provide unprecedented insights into substrate recognition, the two-step reaction mechanism, and the structural basis for fatty acid selectivity.

  • AI-based protein structure prediction (AlphaFold2/RoseTTAFold):

    • Advantages: Can predict structures of proteins with limited experimental data, including challenging membrane proteins.

    • Applications for ZDHHC7: Could model the complete ZDHHC7 structure and predict structural changes associated with mutations or substrate binding.

    • Implementation strategy: Generate models of ZDHHC7 and validate key structural features through targeted experimental approaches such as crosslinking mass spectrometry or FRET-based distance measurements.

    • Impact: Would accelerate structure-based drug design and enable virtual screening for selective ZDHHC7 modulators.

  • Integrative structural biology approaches:

    • Combined methodologies: Molecular dynamics simulations based on cryo-EM or AI-predicted structures could reveal dynamic aspects of ZDHHC7 function, including conformational changes during the catalytic cycle.

    • Experimental validation: Single-molecule FRET or hydrogen-deuterium exchange mass spectrometry could validate predicted dynamics and substrate interactions.

These advanced approaches would significantly enhance our understanding of how ZDHHC7's structure determines its substrate selectivity and catalytic mechanism, potentially enabling rational design of selective modulators for both research and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.