Recombinant Rat Pannexin-3 (Panx3)

Shipped with Ice Packs
In Stock

Description

Osteoblast Differentiation

  • Recombinant Panx3 promotes osteogenesis by:

    • Activating Ca²⁺/calmodulin (CaM) signaling via ER calcium release .

    • Enhancing Akt phosphorylation to degrade p53, a negative regulator of osteogenesis .

    • Propagating intercellular Ca²⁺ waves through gap junctions .

Chondrocyte Regulation

  • In ATDC5 chondrogenic cells, Panx3:

    • Reduces intracellular cAMP levels by releasing ATP, inhibiting proliferation .

    • Increases expression of differentiation markers (e.g., collagen type X) .

Disease Models

  • Panx3-knockout mice exhibit:

    • Delayed skeletal development and osteoarthritis-like phenotypes .

    • Impaired vascular endothelial growth factor (VEGF) signaling in cartilage .

Antibodies

  • Anti-Panx3 Antibodies: Detect endogenous and recombinant Panx3 in Western blot (WB), immunofluorescence (IF), and ELISA .

  • Functional Blocking Antibodies: Inhibit Panx3 channel activity in chondrocytes and osteoblasts .

Pre-coupled Magnetic Beads

  • Used for affinity purification and protein interaction studies .

Key Research Insights

Study FocusMajor FindingCitation
Osteoblast DifferentiationPanx3 ER Ca²⁺ channels activate CaMKII/NFATc1 pathways
ATP ReleasePanx3 hemichannels reduce cAMP/CREB signaling
Gap Junction FunctionPanx3 propagates Ca²⁺ waves between osteoblasts

Limitations and Future Directions

  • Current Challenges:

    • Limited structural data on Panx3 channel stoichiometry .

    • Species-specific differences in post-translational modifications .

  • Therapeutic Potential:

    • Targeting Panx3 may alleviate osteoarthritis or enhance bone regeneration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the most accurate delivery time.
Note: All protein shipments are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Panx3; Px3; Pannexin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Panx3
Target Protein Sequence
MSLAHTAAEYMLSDALLPDRRGSRLKGLRLELPLDKMVKFVTVGFPLLLMSLAFAQEFSS GSPISCFSPSNFSVRQAVFVDSSCWDSLAHYKQDEAGQYTVKSLWPHKALPYSLLALAVA MYLPVLLWQYAAVPALSSDLLFIISELDKSYNRSIRLVQHMLKIRQKSSDPHVFWDELEK ARKERYFEFPLLERYLACKQRSHWLVATYLLRNALLLLFTSATYLYLGHFHLDVFFQEEF SCSIKTGLLHEETHVPELITCRLTSLSVFQIVSVSSVAIYTVLVPVIIYNLTRLCRWDKR LLSIYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLCVLKDTTTQKH NIDTVVDFMTLLAGLEPSKPKHLTQHTYDEHP
Uniprot No.

Target Background

Function
Pannexin-3 (Panx3) serves as a structural component of gap junctions and hemichannels.
Gene References Into Functions
  1. Pituitary gland expresses mRNA and protein transcripts of pannexins 1 and 2, but not pannexin 3. PMID: 21467198
Database Links
Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Skin.

Q&A

What is the molecular structure and function of Pannexin-3?

Pannexin-3 (Panx3) is an integral membrane glycoprotein belonging to the pannexin family, which shares homology with invertebrate gap junction proteins called innexins . Panx3 functions primarily as:

  • A hemichannel at the cell surface facilitating ATP release into extracellular space

  • An endoplasmic reticulum (ER) Ca²⁺ leak channel regulating intracellular calcium signaling

  • A component in purinergic signaling pathways

Structurally, Panx3 forms a channel with a molecular weight of approximately 43 kDa, though some antibodies detect additional immunoreactive species at 50 kDa and 70 kDa that appear to be non-specific .

What is the tissue distribution pattern of Panx3?

While initially thought to have limited expression, Panx3 has been detected in multiple tissues:

  • Musculoskeletal system: cartilage, bone (particularly in osteoblasts and chondrocytes)

  • Dental tissues: odontoblasts and preodontoblasts

  • Other tissues: skeletal muscle, mammary glands, male reproductive tract, cochlea, blood vessels, small intestines, and the vomeronasal organ

In developing tissues such as growth plates, Panx3 is predominantly expressed in prehypertrophic chondrocytes and preodontoblasts during tooth development .

How should researchers validate the specificity of Panx3 antibodies?

Antibody validation is critical as non-specific binding has been documented with certain Panx3 antibodies:

  • Use Panx3 knockout (KO) mouse models as negative controls - the most reliable method to assess antibody specificity

  • Compare multiple antibodies targeting different epitopes of Panx3

  • Perform Western blot analysis to verify detection of the expected 43 kDa species rather than the non-specific 50 kDa and 70 kDa bands seen with some antibodies

  • For functional blocking assays, include peptide competition controls with both target peptide and scrambled sequence peptides

Example of a validated antibody approach: A rabbit polyclonal antibody targeting the peptide sequence HHTQDKAGQYKVKSLWPH from the first extracellular loop of mouse Panx3 protein has been successfully purified by peptide affinity column for use in immunohistochemistry, Western blotting, and functional blocking assays .

What expression systems are most effective for producing recombinant Rat Panx3?

Multiple expression systems have been successfully employed for Panx3 production:

Expression SystemAdvantagesConsiderationsTypical Purity
E. coliHigh yield, cost-effectiveLacks post-translational modifications≥85% by SDS-PAGE
Mammalian cells (HEK293)Native-like post-translational modificationsLower yield, higher cost≥85% by SDS-PAGE
Cell-free expression systemsRapid production, avoids toxicity issuesVariable yield≥85% by SDS-PAGE
BaculovirusIntermediate complexity modificationsModerate yield≥85% by SDS-PAGE
YeastCost-effective, some modificationsVariable functionality≥85% by SDS-PAGE

When selecting an expression system, consider that Panx3 is a membrane protein with glycosylation sites, which may influence function and localization .

How can researchers effectively measure Panx3 channel activity?

Pannexin channel function can be assessed through several methodological approaches:

  • ATP release assays: Measure extracellular ATP levels using luciferase-based luminescence assays to quantify Panx3 hemichannel activity

  • Calcium imaging: Monitor intracellular Ca²⁺ flux using fluorescent indicators (e.g., Fura-2 AM) to assess Panx3 ER Ca²⁺ channel function

  • Dye uptake assays: Evaluate channel permeability using fluorescent dyes like YO-PRO-1

  • Patch-clamp electrophysiology: Directly measure channel conductance

For inhibitor studies, consider using:

  • Carbenoxolone (CBX): Use concentrations <100 μM for specificity

  • Probenecid: Effective at ~150 μM without affecting connexin channels

  • Mefloquine: Blocks Panx1 with high affinity; may have effects on Panx3

Note that inhibitor efficacy may vary based on experimental conditions and potential interactions with other proteins like Kvbeta3 .

What are the recommended approaches for Panx3 gain-of-function and loss-of-function studies?

Gain-of-function approaches:

  • Transfection of cell lines (e.g., ATDC5, N1511, mDP) with Panx3 expression vectors

  • Use of recombinant Panx3 protein for biochemical studies

  • Inducible expression systems for temporal control

Loss-of-function approaches:

  • siRNA-mediated knockdown for transient suppression

  • shRNA for more stable suppression

  • CRISPR/Cas9 gene editing for complete knockout

  • Function-blocking antibodies (10 ng/ml of affinity-purified antibody has been effective)

  • Panx3 knockout mouse models for in vivo studies

When conducting knockdown experiments, researchers have observed that Panx3 siRNA inhibits key processes including AMPK phosphorylation, p21 expression, and Smad1/5/8 phosphorylation even in the presence of BMP2 .

How does Panx3 regulate the transition from cell proliferation to differentiation?

Panx3 serves as a critical molecular switch regulating the transition from proliferation to differentiation in multiple cell types through several mechanisms:

  • ATP/cAMP pathway regulation:

    • As a hemichannel, Panx3 releases intracellular ATP into extracellular space

    • This reduces intracellular ATP and subsequently decreases cAMP levels

    • Reduced cAMP leads to decreased protein kinase A (PKA) activity and reduced CREB phosphorylation

    • These changes inhibit cell proliferation pathways

  • AMPK/p21 signaling activation:

    • Panx3-mediated ATP release activates AMP-activated protein kinase (AMPK)

    • AMPK activation induces p21 expression

    • p21 functions as a cyclin-dependent kinase inhibitor that promotes cell cycle exit

    • This pathway specifically upregulates p21 but not p27

  • BMP/Smad signaling enhancement:

    • Panx3 promotes BMP2-induced phosphorylation of Smad1/5/8

    • This enhances expression of differentiation markers such as DSPP in odontoblasts

    • In osteoblasts, this pathway activates osteoblast-specific gene expression

  • Wnt/β-catenin signaling inhibition:

    • Panx3 promotes β-catenin degradation via GSK3β activation

    • This reduces cell proliferation signals in osteoprogenitor cells

These integrated mechanisms allow Panx3 to orchestrate the precise timing of cell cycle exit and subsequent differentiation in multiple lineages.

How do mouse Panx3 knockout models inform our understanding of Panx3 function?

Panx3 knockout mouse models have revealed crucial insights into its physiological roles:

Reproductive and developmental phenotypes:

  • Reduced litter sizes compared to wild-type mice

  • Heterozygous (Panx3±) crosses produced fewer knockout pups than predicted by Mendelian ratios (8% vs. expected 25%)

  • No differences in weight, size, body composition in aged mice

  • No increased mortality with aging compared to wild-type

Skeletal abnormalities:

  • More severe skeletal phenotypes than Cx43 knockout mice

  • Elongated proliferative and pre-hypertrophic zones in growth plates

  • Thinner and disorganized hypertrophic and terminal chondrocyte domains

  • Delayed terminal differentiation of chondrocytes due to dysregulation of VEGF and MMP13 expression

Functional redundancy investigations:

  • Studies using combined Panx3−/−;Cx43−/− double knockout mice suggest Panx3 regulates Cx43 expression through multiple pathways:

    • Wnt/β-catenin signaling modulation

    • Osx pathway activation via CaM/NFAT signaling

These findings highlight Panx3's critical role in developmental processes, particularly in skeletal formation and cell differentiation programs.

How do researchers address contradictory findings regarding Panx3 function across different model systems?

Several strategies can address contradictory findings in Panx3 research:

  • Model system considerations:

    • Compare findings across species: For example, chicken embryo PANX3 knockdown showed milder effects on chondrocyte differentiation than mouse models

    • Evaluate divergence between in vitro cell lines and in vivo models

    • Consider temporal aspects of development that may influence results

  • Technical validation approaches:

    • Utilize multiple independent knockdown/knockout strategies

    • Confirm phenotypes with rescue experiments

    • Validate antibody specificity with knockout controls

    • Address potential compensation by related proteins (e.g., other Pannexins or Connexins)

  • Signaling pathway integration:

    • Map contradictory findings to specific signaling pathways

    • Consider crosstalk between pathways

    • Evaluate cell type-specific effects

  • Reproducibility considerations:

    • Standardize experimental conditions

    • Report detailed methodologies

    • Consider statistical power and biological replicates

For example, contradictory results were observed between mouse knockout models and chicken embryo knockdown studies regarding PANX3's role in chondrocyte differentiation. While mouse Panx3 knockout showed disrupted chondrogenesis with elongated proliferative zones , chicken embryo PANX3 knockdown (3.6-fold reduction) showed only mild effects with 20% reduction in forelimb bone volumes but no differences in chondrocyte density, proliferation, or differentiation markers . These differences may reflect species-specific mechanisms, knockdown efficiency versus complete knockout, or developmental timing differences.

What are the emerging applications of Panx3 research beyond developmental biology?

Recent research highlights expanding roles for Panx3 beyond development:

  • Disease implications:

    • Potential involvement in osteoarthritis pathogenesis

    • Roles in dental pulp regeneration and repair

    • Possible functions in cancer progression or suppression

  • Regenerative medicine applications:

    • Modulation of Panx3 to control stem cell differentiation

    • Potential targets for enhancing bone and cartilage repair

    • Development of biomaterials incorporating Panx3 signaling principles

  • Drug discovery opportunities:

    • Development of specific Panx3 modulators as research tools

    • Potential therapeutic targeting in disorders of bone and cartilage

    • Screening compounds that regulate Panx3 expression or function

  • Comparative biology insights:

    • Evolution of pannexin channel functions across species

    • Functional specialization compared to connexin family members

    • Tissue-specific adaptations of channel properties

Researchers investigating these emerging areas should consider interdisciplinary approaches combining developmental biology, cell signaling, pharmacology, and clinical sciences.

What are the best practices for preserving recombinant Panx3 stability and function?

Maintaining Panx3 stability presents challenges due to its membrane protein nature:

  • Purification considerations:

    • Use mild detergents (e.g., digitonin, DDM) for membrane protein extraction

    • Consider native-like membrane environments (nanodiscs, liposomes)

    • Maintain glycosylation for proper folding and function

    • Aim for ≥85% purity as determined by SDS-PAGE

  • Storage recommendations:

    • Store at -80°C in aliquots to avoid freeze-thaw cycles

    • Include protease inhibitors in storage buffers

    • Consider stabilizing additives appropriate for downstream applications

    • For long-term storage, lyophilization may be considered for some preparations

  • Functional assessment validation:

    • Verify channel activity before and after storage

    • Assess oligomerization state with native PAGE or BN-PAGE

    • Evaluate glycosylation patterns with glycosidase treatments

    • Confirm membrane insertion in reconstitution systems

These practices help ensure that recombinant Panx3 retains its native structure and function for reliable experimental outcomes.

How can researchers effectively study Panx3 interactions with signaling pathways?

To investigate Panx3's intricate interactions with various signaling pathways:

  • For BMP/Smad pathway interactions:

    • Measure Smad1/5/8 phosphorylation via Western blotting

    • Use BMP2 (typically 200 ng/ml) as a pathway stimulator

    • Compare wild-type and Panx3-overexpressing or Panx3-knockdown cells

    • Assess expression of downstream targets (e.g., DSPP in odontoblasts)

  • For AMPK/p21 pathway analysis:

    • Use AICAR as an AMPK activator to verify pathway effects

    • Monitor AMPK phosphorylation status

    • Measure p21 (but not p27) expression levels

    • Assess cell proliferation phenotypes

  • For Wnt/β-catenin pathway studies:

    • Examine GSK3β phosphorylation status

    • Quantify β-catenin degradation rates

    • Use TOPFlash reporter assays for pathway activity

    • Analyze expression of Wnt target genes

  • For calcium signaling investigations:

    • Employ calcium imaging techniques

    • Use calcium channel blockers as controls

    • Consider ER calcium stores specifically

    • Examine CaM/NFAT pathway activation

These approaches help dissect the specific mechanisms by which Panx3 influences cell fate decisions across multiple lineages.

What are the emerging technologies that could advance Panx3 research?

Several cutting-edge approaches are poised to transform Panx3 research:

  • Single-cell analysis techniques:

    • Single-cell RNA-seq to identify cell populations expressing Panx3

    • Spatial transcriptomics for tissue localization

    • CyTOF for protein-level characterization

    • Live-cell imaging of Panx3 trafficking and function

  • Advanced structural biology methods:

    • Cryo-EM for high-resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • In silico molecular dynamics simulations of channel function

    • FRET-based assays for real-time conformational changes

  • Genome editing approaches:

    • CRISPR/Cas9 for precise genetic manipulation

    • Conditional knockout models for tissue-specific studies

    • Base editing for introducing specific mutations

    • Optogenetic or chemogenetic control of Panx3 function

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics

    • Network analysis of Panx3-interacting pathways

    • Mathematical modeling of channel dynamics

    • Machine learning for predicting Panx3 functions in different contexts

These technologies will enable researchers to address more nuanced questions about Panx3 biology and its therapeutic potential.

What are the critical knowledge gaps in our understanding of Panx3 function?

Despite significant advances, several important questions remain unresolved:

  • Structural-functional relationships:

    • What are the gating mechanisms of Panx3 channels?

    • How do post-translational modifications regulate channel activity?

    • What is the stoichiometry of functional Panx3 channels?

    • How do Panx3 channels differ structurally from other pannexins and connexins?

  • Signaling pathway integration:

    • How does Panx3 coordinate multiple signaling pathways simultaneously?

    • What determines the specificity of Panx3 effects in different cell types?

    • Are there direct protein interactions beyond channel function?

    • How is Panx3 expression itself regulated during development and disease?

  • Physiological and pathological roles:

    • What is the full spectrum of Panx3's roles in adult tissues beyond development?

    • How does Panx3 contribute to tissue regeneration after injury?

    • Is Panx3 dysregulation involved in skeletal or dental pathologies?

    • Could Panx3 be a therapeutic target for bone or cartilage disorders?

  • Evolutionary considerations:

    • How has Panx3 function evolved compared to other pannexins?

    • What are the species-specific differences in Panx3 regulation and function?

    • Is there functional redundancy with connexins that explains evolutionary conservation?

Addressing these knowledge gaps will require interdisciplinary approaches and the development of new research tools and models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.