Recombinant Rat Paraplegin (Spg7)

Shipped with Ice Packs
In Stock

Description

General Information

Paraplegin is a mitochondrial metalloprotease protein encoded by the SPG7 gene in humans . It belongs to the AAA protein family, characterized by an ATPase domain and roles in membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis . The SPG7 protein is a transmembrane protein located in the inner mitochondrial membrane and is part of the m-AAA metalloproteinase complex, which functions in mitochondrial protein quality control .

Function and Structure

Paraplegin, the product of the SPG7 gene, is a component of the m-AAA protease, a high molecular weight complex residing in the mitochondrial inner membrane . It interacts with AFG like AAA ATPase 2 (AFG3L2) on the mitochondrial inner membrane to form the m-AAA metalloproteinase complex .

A novel splicing isoform of paraplegin, named paraplegin-2, is encoded by alternative splicing of Spg7 through the usage of an alternative first exon . Paraplegin-2 lacks the mitochondrial targeting sequence and is identical to the mature mitochondrial protein . Paraplegin-2 is targeted to the endoplasmic reticulum and exposes the catalytic domains to the lumen of the endoplasmic reticulum .

Clinical Significance

Mutations in the SPG7 gene cause autosomal recessive spastic paraplegia 7, a neurodegenerative disorder characterized by gradual weakness and spasticity in the lower limbs . SPG7 mutations have also been associated with undiagnosed ataxia . SPG7 deficiency is associated with abnormal mitochondrial DNA maintenance, potentially leading to secondary mitochondrial DNA lesions, impaired respiratory activities, and mitochondrial functions .

Research Findings

SPG7 encodes for paraplegin protein . Studies have indicated a direct link between mitochondrial and neuronal defects in HSP-SPG7 patient neurons .

RNA-Seq analysis on HSP-SPG7 patient and healthy control neurons revealed a clear distinction in gene expression profiles . Although HSP-SPG7 patient neurons were less complex, shorter, and had increased degeneration, they expressed mature cortical neuron markers .

In model animals, siRNA knockdown of spastic paraplegia 7 inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1 . An SPG7 variant can escape phosphorylation-regulated processing by AFG3L2, increasing mitochondrial reactive oxygen species generation, which is correlated with many clinical phenotypes .

Mice deficient in paraplegin (Spg7–/–) display a statistically significant loss of body weight compared with heterozygous littermates at 12 months of age .

Alternative Splicing of Spg7

Alternative splicing of the murine Spg7 gene includes an upstream, alternative first exon . This transcript encodes paraplegin-2 that does not possess the MTS and localizes to the endoplasmic reticulum (ER) . Paraplegin-2 is expressed in vivo in both mouse retina and brain and is still present in Spg7 knock-out mice .

Paraplegin Expression

Paraplegin expression was comparable between patient and control neurons . It is plausible that the paraplegin protein expressed is non-functional .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Spg7; Paraplegin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-744
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Spg7
Target Protein Sequence
MAAALLLLRALRQSPEPGPWRLWAQLSGRSPGLFSGAGGRRPYVVRGTPIGLAAAGGHTP QSLLLRILTPSFEGVSGLLLKRHIVPSAIRLWQLSGSTLYFNTSGLKQKNKDDDKPKGKA PEDDEEERRRKEREDQMYRERLRTLFIIAIVMSLLNSLSTSGGSISWADFVNEMLAKGEV QRVQVVPESDVVEVYLHPGAVVFGRPRLALMYRMQVANIDKFEEKLRAAEDELNIESKDR IPVSYKRTGFFGNALYALGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDG KTGKGVSFQDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAK AVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTS MSGFSNTEEEQTLNQLLVEMDGMGTADHVIVLASTNRADVLDNALMRPGRLDRHVFIDLP TLQERREIFEQHLKGLKLTQPSSFYSQRLAELTPGFSGTAKKSKILSKEEQRVVAFHESG HALVGWLLEHTEAVMKVSIAPRTNAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEA ISFSRVTSGAQDDLRKVTRIAYSMVKQFGMAPSIGPVSFPEAQEGLVGIGRRPFSQGLQQ MMDHEARLLVARAYRHTEKVLLDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPKKM IAPQKWIDAEKEKQASGEEEAPAP
Uniprot No.

Target Background

Function
Recombinant Rat Paraplegin (Spg7) is an ATP-dependent zinc metalloprotease. It plays a role in the formation and regulation of the mitochondrial permeability transition pore (mPTP), although its proteolytic activity is not essential for this function.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is paraplegin and what is its cellular localization?

Paraplegin (also known as SPG7, CAR, CMAR, or PGN) is a 795 amino acid metalloprotease belonging to the AAA protein family. It is primarily localized to the mitochondrial membrane and is expressed throughout the body. As a multi-pass membrane protein, paraplegin plays crucial roles in signal transduction and performs chaperone-like activities in the mitochondria . Interestingly, there exists an alternative splicing variant called paraplegin-2 that lacks the mitochondrial targeting sequence and is instead targeted to the endoplasmic reticulum . This dual localization pattern suggests complex regulatory mechanisms controlling paraplegin's subcellular distribution.

What is the molecular function of paraplegin in mitochondria?

Paraplegin functions as a component of the m-AAA protease, a high molecular weight complex residing in the mitochondrial inner membrane. This complex performs crucial quality control and biogenesis functions in mitochondria . The protein contributes to the degradation of misfolded proteins and regulates the assembly of respiratory chain complexes. Paraplegin's metalloprotease activity is essential for proteolytic processing of mitochondrial proteins, while its ATPase activity enables chaperone-like functions critical for maintaining mitochondrial homeostasis.

What alternative isoforms of paraplegin exist and how do they differ functionally?

Research has revealed the existence of an alternative isoform of paraplegin in mice, termed paraplegin-2, which is encoded by alternative splicing of the Spg7 gene through the usage of an alternative first exon. Unlike the canonical paraplegin, paraplegin-2 lacks the mitochondrial targeting sequence but is otherwise identical to the mature mitochondrial protein. The key difference is that paraplegin-2 is targeted to the endoplasmic reticulum, where it exposes its catalytic domains to the ER lumen . This suggests distinct functional roles in different cellular compartments. Endogenous paraplegin-2 has been detected in microsomal fractions prepared from mouse brain and retina, confirming its expression in vivo .

What are the optimal methods for expressing and purifying recombinant rat paraplegin?

When expressing recombinant rat paraplegin, researchers should consider its subcellular localization patterns. For mitochondrial paraplegin, expression systems must include the mitochondrial targeting sequence, while paraplegin-2 should be expressed without this sequence. Purification typically involves:

  • Cloning the full-length or mature form of rat Spg7 into appropriate expression vectors

  • Expressing in eukaryotic systems (preferred over bacterial systems due to proper folding requirements)

  • Using affinity tags (His or GST) positioned to avoid interference with functional domains

  • Implementing a two-step purification strategy combining affinity chromatography with size-exclusion chromatography

  • Verifying purity through Western blotting using specific antibodies like the Santa Cruz H-180 antibody (sc-135026)

The metalloprotease activity of recombinant paraplegin can be verified using fluorogenic peptide substrates specific for AAA proteases.

How can researchers detect endogenous versus recombinant paraplegin in experimental systems?

Detection of endogenous versus recombinant paraplegin requires careful consideration of isoform-specific properties:

  • Subcellular fractionation approach: Separate mitochondrial and microsomal fractions to distinguish between canonical paraplegin and paraplegin-2. This can be achieved through differential centrifugation followed by Western blotting .

  • Antibody selection: Use antibodies that recognize specific epitopes, such as the Santa Cruz H-180 antibody (sc-135026), which can detect both isoforms. For isoform-specific detection, antibodies targeting the N-terminal region can distinguish between mitochondrial paraplegin (contains mitochondrial targeting sequence) and paraplegin-2 (lacks this sequence) .

  • Controls for verification: When using rat skeletal muscle tissue extract as a positive control, researchers should expect to detect a band at approximately 80 kDa for full-length paraplegin and approximately 70 kDa for the mature processed form .

  • Recombinant tagging strategy: When introducing recombinant paraplegin, use epitope tags (e.g., FLAG, HA) to differentiate from endogenous protein.

What are the technical challenges in studying paraplegin's function in mitochondria versus endoplasmic reticulum?

Studying paraplegin's function across different cellular compartments presents several technical challenges:

  • Isoform-specific knockout models: Standard gene knockout approaches may not selectively target specific isoforms. The previously developed Spg7 knockout mouse model targeted exons 1 and 2, specifically ablating mitochondrial paraplegin while retaining paraplegin-2 expression . This highlights the need for isoform-specific targeting strategies.

  • Organelle cross-contamination: When isolating mitochondrial and microsomal fractions, cross-contamination can occur. Researchers should verify the purity of fractions using compartment-specific markers such as AFG3L2 and the 70 kDa subunit of Complex II for mitochondria .

  • Functional assays: Different assays are needed to evaluate paraplegin function in distinct compartments. Mitochondrial paraplegin activity affects respiratory chain complex assembly and mitochondrial morphology, while paraplegin-2 functions in the ER remain less characterized and may involve ER protein quality control pathways.

  • Visualization techniques: Immunofluorescence microscopy for co-localization studies requires careful selection of organelle-specific markers and high-resolution imaging to distinguish between mitochondrial and ER localization.

How do SPG7 mutations affect paraplegin function in hereditary spastic paraplegia?

SPG7 mutations cause an autosomal recessive form of hereditary spastic paraplegia through multiple mechanisms of protein dysfunction:

  • Mutation diversity: To date, at least 77 different variants have been identified in the SPG7 gene, including missense, nonsense, splice, frameshift, and exon deletion variants . This genetic heterogeneity results in varied functional consequences.

  • Phenotypic expression: SPG7 mutations can result in either simple or complex phenotypes. Complex phenotypes may include cerebellar ataxia, optic neuropathy, and ophthalmoparesis. Cerebellar atrophy detected by cranial MRI is one of the most common features .

  • Functional consequences: Mutations disrupt paraplegin's metalloprotease activity, interfering with mitochondrial quality control. This leads to the accumulation of abnormal mitochondria in affected axons, particularly evident in long motor neurons of the corticospinal tract .

  • Disease progression: In clinical studies, disease progression varies based on specific mutations. For instance, compound heterozygous mutations (c.850_851delTTinsC and c.1742_1744delTGG) have been associated with rapid disease progression, resulting in severe symptoms after just 8 years .

What are the advantages of using rat models compared to other organisms for studying paraplegin-related disorders?

Rat models offer several distinct advantages for studying paraplegin-related disorders:

  • Anatomical and physiological similarity to humans: Rats have larger brain and spinal cord compared to mice, allowing for more detailed analysis of neurodegeneration patterns in the corticospinal tract.

  • Complex behavioral assessment: Rats permit more sophisticated behavioral testing to assess motor function, which is crucial when studying progressive mobility impairments characteristic of HSP.

  • Temporal progression: The disease progression in rats more closely mimics the human condition, providing a better temporal window to study early, middle, and late disease stages.

  • Tissue yield: Larger tissue samples from rats facilitate multiple analytical approaches from the same animal, reducing experimental variability.

  • Therapeutic testing: Larger size enables more accurate delivery of experimental therapeutics, such as the AAV-mediated gene therapy approaches that have shown promise in paraplegin-deficient models .

How can researchers distinguish between primary effects of paraplegin deficiency and secondary consequences in disease models?

Distinguishing between primary and secondary effects requires systematic experimental approaches:

  • Temporal analysis: Track changes chronologically in paraplegin-deficient models to identify which abnormalities appear first. In mouse models, morphologically abnormal mitochondria appear early in affected axons and become more pronounced with aging, suggesting this as a primary effect .

  • Compartment-specific analysis: Examine both mitochondrial and ER functions separately, as paraplegin exists in both compartments. This helps distinguish which cellular processes are directly affected by paraplegin deficiency.

  • Rescue experiments: Selective restoration of paraplegin function in specific compartments can identify which defects are directly related to paraplegin loss. Studies have shown that intramuscular delivery of Spg7 cDNA through AAV vectors in knockout mice halted the progression of neuropathological changes and rescued mitochondrial morphology .

  • Analysis of interacting pathways: Examining the effects on known paraplegin-interacting proteins and pathways can help determine which defects are direct consequences of paraplegin deficiency versus compensatory responses.

  • Cross-species validation: Comparing phenotypes across different model organisms (yeast, flies, mice, rats, human cells) can help identify conserved primary effects of paraplegin deficiency.

How does recombinant paraplegin interact with other components of the m-AAA protease complex?

The m-AAA protease complex is a sophisticated assembly in the mitochondrial inner membrane that requires coordinated interaction between paraplegin and other proteins:

  • Complex assembly: Recombinant paraplegin assembles with AFG3L2 to form the complete m-AAA protease complex. The stoichiometry and assembly dynamics can be studied using techniques like blue native PAGE and co-immunoprecipitation with recombinant components.

  • Functional domains: The AAA domain of paraplegin mediates ATP-dependent functions and complex assembly, while the metalloprotease domain executes the proteolytic activity. When expressing recombinant paraplegin, researchers should preserve the integrity of these domains for proper function.

  • Interaction mapping: Specific regions of paraplegin mediate interactions with other mitochondrial proteins. Structure-function studies with truncated or mutated recombinant paraplegin can map these interaction sites.

  • Regulatory mechanisms: Post-translational modifications of paraplegin affect its interactions within the complex. Recombinant expression systems should be selected that maintain these modifications for authentic interaction studies.

What role does paraplegin play in neurodegenerative processes beyond hereditary spastic paraplegia?

Paraplegin's functions extend beyond its established role in HSP, with implications for broader neurodegenerative mechanisms:

  • Mitochondrial quality control: As a component of the mitochondrial quality control system, paraplegin may influence multiple neurodegenerative diseases where mitochondrial dysfunction is implicated, including Parkinson's disease and amyotrophic lateral sclerosis.

  • Neuropsychiatric manifestations: Some SPG7 patients exhibit cognitive impairment and psychosis, including persecutory delusions. This suggests paraplegin may play a role in circuits relevant to psychiatry, potentially through effects on cerebellar-thalamic-cortical-cerebellar (CTCC) circuits .

  • Neuroprotective mechanisms: Paraplegin's protective role against mitochondrial stress may be relevant to general neuroprotective mechanisms. Studies with recombinant paraplegin can evaluate its potential to mitigate neuronal damage under various stress conditions.

  • Axonal maintenance: The progressive axonal degeneration observed in paraplegin deficiency models suggests a critical role in axonal maintenance that may be relevant to other axonopathies.

How can CRISPR-Cas9 technology be used to create precise models of paraplegin dysfunction?

CRISPR-Cas9 technology offers unprecedented precision for creating models of paraplegin dysfunction:

  • Isoform-specific editing: Unlike traditional knockout approaches that eliminated exons 1 and 2 (affecting only mitochondrial paraplegin while sparing paraplegin-2) , CRISPR-Cas9 can be used to selectively disrupt either or both isoforms by targeting specific exons or regulatory elements.

  • Patient-specific mutations: CRISPR-Cas9 can introduce specific mutations identified in HSP patients, such as the c.1150_1151insCTAC (p.G384Afs*13) variant common in Chinese patients or the p.Ala510Val variant prevalent in UK populations .

  • Conditional systems: Combining CRISPR-Cas9 with inducible systems allows temporal control over paraplegin disruption, enabling studies of acute versus chronic loss.

  • Tissue-specific models: Using tissue-specific promoters to drive Cas9 expression can restrict paraplegin disruption to specific cell types, allowing examination of cell-autonomous versus non-cell-autonomous effects.

  • Base editing applications: For missense mutations, newer base editing CRISPR systems can introduce precise nucleotide changes without double-strand breaks, more faithfully modeling the genetic situation in patients.

What are the challenges in distinguishing the functions of paraplegin isoforms in different subcellular compartments?

Understanding the compartment-specific functions of paraplegin presents several challenges:

  • Isoform-specific tools: Developing antibodies and other molecular tools that can specifically detect and manipulate each paraplegin isoform remains technically challenging. The close similarity between mature mitochondrial paraplegin and paraplegin-2 complicates specific targeting .

  • Functional redundancy: Potential overlap in functions between paraplegin isoforms may mask phenotypes in single-isoform knockout models, necessitating sophisticated conditional and combinatorial approaches.

  • Compartment crosstalk: Mitochondria and ER have extensive physical and functional contacts, making it difficult to isolate effects specific to paraplegin in one compartment versus the other.

  • Expression patterns: The relative expression levels of paraplegin isoforms may vary across tissues and developmental stages. Comprehensive characterization of these patterns is needed to interpret phenotypes correctly.

  • Interactome differences: Each paraplegin isoform likely interacts with a different set of proteins in its respective compartment. Comprehensive interactome mapping is required to understand the full functional implications.

How can recombinant paraplegin be used to develop therapeutic strategies for SPG7-related disorders?

Recombinant paraplegin offers several avenues for therapeutic development:

  • Enzyme replacement therapy: Purified recombinant paraplegin, potentially modified for enhanced cellular uptake and targeted delivery to affected tissues, could compensate for loss of endogenous protein.

  • Gene therapy vectors: As demonstrated in mouse models, AAV vectors carrying the Spg7 cDNA can halt disease progression and rescue mitochondrial morphology . Optimized recombinant constructs could improve delivery efficiency and expression.

  • Drug screening platforms: Recombinant paraplegin can be used in high-throughput screens to identify small molecules that stabilize mutant paraplegin or enhance the activity of remaining functional protein.

  • Structure-based drug design: Purified recombinant paraplegin enables structural studies to guide the design of molecules that mimic or enhance its function.

  • Combination approaches: Recombinant paraplegin studies can identify complementary pathways for therapeutic targeting, potentially leading to combination therapies addressing multiple aspects of disease pathogenesis.

What is the relationship between paraplegin and other proteins implicated in hereditary spastic paraplegias?

The complex relationship between paraplegin and other HSP-related proteins reveals potential convergent disease mechanisms:

  • Interaction with spastin: Spastin, encoded by the SPAST gene and implicated in the most common autosomal dominant form of HSP, interacts with endosomal proteins involved in membrane trafficking . Both paraplegin and spastin may affect common pathways related to membrane dynamics and trafficking.

  • Mitochondrial network: Several HSP-related proteins localize to mitochondria, suggesting a mitochondrial nexus in disease pathogenesis. How paraplegin functions within this broader network remains to be fully characterized.

  • Functional convergence: Despite genetic heterogeneity (over 70 different genes implicated in HSP), affected proteins often participate in related cellular processes. Understanding how paraplegin fits within these pathways may reveal common therapeutic targets.

  • Phenotypic modifiers: The variable expressivity of SPG7 mutations suggests the presence of genetic modifiers. Identifying these modifiers among other HSP-related proteins could provide new therapeutic insights.

  • Pathological interaction: Potential pathological interactions between mutant paraplegin and other HSP proteins might contribute to disease severity or progression, representing an understudied area for therapeutic intervention.

What are the common mutations in SPG7 and their frequencies across populations?

Research has identified distinct mutation patterns in the SPG7 gene across different populations:

PopulationCommon MutationFrequencyPhenotypic FeaturesReference
Chinesec.1150_1151insCTAC (p.G384Afs*13)Potential hotspotSpastic-ataxia, cerebellar atrophy
UKp.Ala510ValMost commonVariable, often with cerebellar signs
Moroccanc.850_851delTTinsC and c.1742_1744delTGG (compound heterozygous)Family-specificComplex HSP with cerebellar impairment, rapid progression

Mutation analysis studies have identified at least 77 different variants in SPG7, including missense, nonsense, splice, frameshift, and exon deletion variants . The high frequency of rare nucleotide variants in SPG7 complicates routine diagnosis and suggests population-specific testing strategies may be beneficial .

What cellular phenotypes are associated with paraplegin deficiency in experimental models?

Paraplegin deficiency leads to several distinctive cellular phenotypes that progress over time:

  • Mitochondrial abnormalities: The earliest and most consistent finding is morphologically abnormal mitochondria in affected axons, which become more pronounced with aging .

  • Axonal degeneration: Progressive retrograde axonal degeneration occurs in multiple neuronal populations, including:

    • Long descending motor spinal tracts

    • Long ascending sensory spinal tracts

    • Peripheral nerves

    • Optic nerves

  • Cellular compartment effects: The Spg7 knockout mouse model revealed:

    • Progressive motor impairment beginning at 4.5 months of age

    • Preservation of paraplegin-2 expression in the endoplasmic reticulum

    • Different effects in mitochondrial versus microsomal compartments

  • Tissue-specific manifestations: Brain and retina show distinctive patterns of paraplegin expression and pathology, with paraplegin-2 detected in microsomal fractions from both tissues even in mitochondrial paraplegin knockout models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.