Recombinant Rat PDZK1-interacting protein 1 (Pdzk1ip1)

Shipped with Ice Packs
In Stock

Description

TGF-β/BMP Pathway Regulation

Pdzk1ip1 suppresses TGF-β and BMP signaling by:

  • Trapping Smad4 in the cytoplasm, preventing R-Smad/Smad4 complex formation .

  • Inhibiting TGF-β–induced cell migration and growth arrest .

  • Reducing expression of TGF-β target genes (e.g., Smad7, TMEPAI) .

Table 1: Effects of Pdzk1ip1 Modulation on TGF-β Signaling

InterventionOutcomeModel SystemSource
Overexpression↓ Tumor size, ↑ survival in xenograftsA549 lung cancer
KnockdownSmad7 and TMEPAI expressionRat fibroblasts
Δ(F40–A49) mutationLoss of Smad4-binding abilityHEK293T cells

Gene-Environment Interactions

Pdzk1ip1 expression is modulated by environmental toxins and therapeutics:

Table 2: Environmental Modulators of Pdzk1ip1 Expression

AgentEffect on Pdzk1ip1SpeciesSource
2,3,7,8-Tetrachlorodibenzodioxin↑ mRNARat
Benzo[a]pyrene↓ mRNAHuman
Cisplatin↓ mRNAHuman
Bisphenol A↑ MethylationMouse

Role in Autophagy and Adipogenesis

Pdzk1ip1 regulates lipid metabolism and autophagy in non-cancer contexts:

  • Adipogenesis: Overexpression inhibits goat subcutaneous preadipocyte differentiation by downregulating PPARγ, C/EBPα, and SREBP1 .

  • Autophagy: Enhances LC3-I/II conversion and reduces p62 levels, promoting autophagic flux .

Key Findings:

  • Pdzk1ip1 knockdown increases lipid droplet accumulation by 2.3-fold in preadipocytes .

  • Autophagy inhibition reverses Pdzk1ip1-mediated adipogenesis suppression .

Research Tools and Antibodies

Recombinant Pdzk1ip1 is studied using:

  • Monoclonal Antibodies: Anti-PDZK1IP1 (Clone 4D11) targets residues 1–114, validated for ELISA and Western blotting .

  • Expression Systems: Full-length recombinant Pdzk1ip1 with GST tag (26 kDa) for in vitro assays .

Controversies in Tumorigenic Roles

Pdzk1ip1 exhibits dual roles in cancer:

  • Pro-Tumorigenic: Activates Notch signaling and PI3K/Akt pathways in lung adenocarcinoma .

  • Anti-Tumorigenic: Suppresses TGF-β–driven metastasis in oral squamous cell carcinoma .

Future Directions

  • Mechanistic studies on Pdzk1ip1’s role in redox regulation (e.g., NADPH/glutathione modulation) .

  • Therapeutic targeting in TGF-β–dependent cancers and metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Pdzk1ip1; Map17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pdzk1ip1
Target Protein Sequence
MLALSLLALGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEQE PGSTMMITGNKADGVLVGMDGRYSSMASGFRSSEHKNAFENVLEEEGRVRSTPM
Uniprot No.

Target Background

Gene References Into Functions
  1. A membrane protein that induces high-affinity and specific Na-dependent transport of d-mannose and d-glucose in X. laevis oocytes, most likely through stimulation of the capacity of an endogenous transport system of the oocyte. PMID: 12812916
Database Links

KEGG: rno:81916

UniGene: Rn.3605

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PDZK1IP1 and what structural domains are critical for its function?

PDZK1IP1 (PDZK1-interacting protein 1) is a regulatory protein that interacts with both PDZK1 and Smad4. Its middle region, specifically from Phe-40 to Ala-49, has been identified as crucial for its Smad4-regulating activity . The protein's structure enables it to participate in multiple protein-protein interactions, primarily through specific binding domains that facilitate its regulatory functions. While the complete tertiary structure has not been fully characterized, functional studies have demonstrated that PDZK1IP1 contains distinct regions responsible for protein interaction and signaling regulation.

The functional domains of PDZK1IP1 include:

  • N-terminal region: Involved in protein stability

  • Middle region (Phe-40 to Ala-49): Critical for Smad4 binding and regulation

  • C-terminal region: Contains motifs involved in subcellular localization

Understanding these structural characteristics is essential for designing experiments that investigate PDZK1IP1's molecular interactions and signaling activities.

How does PDZK1IP1 differ from its interacting partner PDZK1?

PDZK1 and PDZK1IP1 are distinct proteins with different structures and functions. PDZK1 contains four PDZ (PSD-95/Dlg/ZO-1) domains and functions as a scaffold protein that regulates multiple signaling pathways . The first PDZ domain in the N-terminal region of PDZK1 is responsible for association with SR-BI (Scavenger Receptor Class B Type I), a high-density lipoprotein receptor . In contrast, PDZK1IP1 functions primarily as a regulatory protein that interacts with PDZK1 and also independently modulates the TGF-β signaling pathway through its interaction with Smad4 .

How does PDZK1IP1 modulate TGF-β signaling pathways?

PDZK1IP1 functions as a negative regulator of both TGF-β and bone morphogenetic protein (BMP) signaling pathways through its interaction with Smad4 . Rather than affecting receptor-regulated Smad (R-Smad) phosphorylation, PDZK1IP1 interferes with TGF-β- and BMP-induced R-Smad/Smad4 complex formation . This mechanism represents a novel level of regulation in the TGF-β signaling cascade.

The regulatory action occurs through multiple mechanisms:

  • PDZK1IP1 prevents the formation of R-Smad/Smad4 complexes upon TGF-β stimulation

  • It retains Smad4 in the cytoplasm of TGF-β-stimulated cells, preventing nuclear translocation

  • PDZK1IP1 knockdown enhances TGF-β target gene expression (Smad7 and TMEPAI)

  • Overexpression of PDZK1IP1 suppresses TGF-β-induced reporter activities, cell migration, and growth inhibition

These findings indicate that PDZK1IP1 acts as a cytoplasmic anchor for Smad4, thereby preventing the transcriptional responses typically induced by TGF-β signaling. This regulatory mechanism provides potential therapeutic targets for conditions where TGF-β signaling is dysregulated.

What is the significance of PDZK1IP1's interaction with Smad4?

PDZK1IP1's interaction with Smad4 represents a critical regulatory mechanism in TGF-β signaling. By retaining Smad4 in the cytoplasm, PDZK1IP1 effectively prevents the formation of transcriptionally active complexes with phosphorylated R-Smads . This interaction is specific and functional, with definitive consequences for downstream gene expression.

The significance of this interaction is multifaceted:

  • It provides a mechanism for fine-tuning TGF-β signaling intensity and duration

  • It explains how cells can regulate TGF-β responses independent of receptor activation

  • It offers insight into the dual nature of TGF-β signaling in cancer, where the pathway can have both tumor-suppressive and tumor-promoting effects depending on context

  • It establishes PDZK1IP1 as a potential therapeutic target for modulating TGF-β signaling in disease states

Research shows that the middle region of PDZK1IP1 (Phe-40 to Ala-49) plays a key role in its Smad4-regulating activity . This domain specificity provides a potential target for designing peptide inhibitors or small molecules that could modulate this interaction for therapeutic purposes.

What expression systems yield optimal results for recombinant rat PDZK1IP1 production?

When producing recombinant rat PDZK1IP1, researchers should consider several expression systems based on experimental requirements:

Expression SystemAdvantagesLimitationsYieldPurification Tags
E. coliHigh yield, cost-effective, rapid expressionPotential lack of post-translational modifications3-5 mg/L cultureHis-tag, GST-tag
Mammalian cells (HEK293, CHO)Proper folding, post-translational modificationsLower yield, higher cost0.5-2 mg/L cultureHis-tag, Fc-tag
Baculovirus/insect cellsHigh expression level, post-translational modificationsModerate complexity, time-consuming2-4 mg/L cultureHis-tag, FLAG-tag

The purification strategy should incorporate affinity chromatography using the appropriate tag, followed by size exclusion chromatography to achieve high purity. The research by Ikeno et al. suggests that proper folding of PDZK1IP1 is critical for its functional interaction with Smad4, particularly in the region from Phe-40 to Ala-49 .

What methods are effective for studying PDZK1IP1-protein interactions in experimental settings?

Several complementary approaches are recommended for investigating PDZK1IP1 protein interactions:

  • Co-immunoprecipitation (Co-IP): Effective for detecting physiological interactions between PDZK1IP1 and binding partners such as Smad4. This method was successfully employed to demonstrate PDZK1IP1's interaction with Smad4 .

  • GST pull-down assays: Useful for mapping interaction domains. By creating truncated versions of PDZK1IP1, researchers identified that the middle region (Phe-40 to Ala-49) is critical for Smad4 binding .

  • Fluorescence microscopy with fluorescently tagged proteins: Enables visualization of protein co-localization in cells. This approach revealed that PDZK1IP1 retains Smad4 in the cytoplasm upon TGF-β stimulation .

  • Yeast two-hybrid screening: Valuable for identifying novel interaction partners of PDZK1IP1 beyond known associations.

  • Surface plasmon resonance (SPR) or biolayer interferometry: Provides quantitative binding kinetics and affinity measurements between purified PDZK1IP1 and its binding partners.

The selection of appropriate methods should be guided by the specific research question. For instance, when studying the functional consequences of PDZK1IP1-Smad4 interaction, combining co-IP with reporter assays for TGF-β target genes provides more comprehensive insights than either method alone .

What is the role of PDZK1IP1 in cancer models and how does it affect tumor progression?

PDZK1IP1 demonstrates significant tumor-suppressive properties in cancer models where TGF-β signaling promotes tumor progression. Research using xenograft tumor models has shown that PDZK1IP1 gain of function decreased tumor size and increased survival rates . This finding is particularly important as it highlights PDZK1IP1's potential role in counteracting the pro-tumorigenic effects of TGF-β signaling in advanced cancers.

The anti-tumor effects of PDZK1IP1 appear to be mediated through multiple mechanisms:

  • Suppression of TGF-β-induced cell migration, which is critical for tumor invasion and metastasis

  • Inhibition of TGF-β-dependent transcriptional programs that promote tumor progression

  • Interference with the formation of R-Smad/Smad4 complexes, which regulate expression of various genes involved in tumor progression

These findings suggest that PDZK1IP1 expression levels may serve as a prognostic marker in certain cancers, particularly those where TGF-β signaling transitions from tumor-suppressive to tumor-promoting roles during disease progression. The differential effects of TGF-β signaling in various tumor types may partially be explained by varying levels of PDZK1IP1 expression, offering a potential explanation for the "TGF-β paradox" in cancer biology .

How can researchers effectively manipulate PDZK1IP1 expression in experimental models?

Researchers can employ several strategies to modulate PDZK1IP1 expression levels in experimental models:

ApproachAdvantagesConsiderationsApplications
siRNA/shRNA knockdownRapid, transient effect, specific targetingPotential off-target effects, incomplete knockdownShort-term functional studies, pathway analysis
CRISPR-Cas9 gene editingComplete knockout, stable cell linesTime-consuming, potential compensation mechanismsLong-term studies, phenotypic analysis
Adenoviral/lentiviral overexpressionHigh efficiency, titratable expressionPotential cytotoxicity, variable expressionGain-of-function studies, rescue experiments
Inducible expression systemsTemporal control, physiological expression levelsSystem complexity, potential leakinessDevelopment-dependent studies, dose-response analysis

For studying PDZK1IP1's effects on TGF-β signaling, researchers have successfully employed both knockdown and overexpression approaches. PDZK1IP1 knockdown enhanced the expression of TGF-β target genes upon stimulation, while overexpression suppressed TGF-β-induced reporter activities and cellular responses .

When designing genetic manipulation studies, it's crucial to include appropriate controls and validate the specificity of the approach. For instance, rescue experiments using PDZK1IP1 variants can confirm that observed phenotypes are specifically due to altered PDZK1IP1 function rather than off-target effects. The research by Ikeno et al. utilized structure-function analysis with PDZK1IP1 variants to identify that the middle region (Phe-40 to Ala-49) is essential for its Smad4-regulating activity .

How does PDZK1IP1 coordinate with other regulatory proteins in signaling networks?

PDZK1IP1 functions within complex signaling networks, interacting with multiple proteins beyond its namesake interaction with PDZK1. While PDZK1 is known to control hepatic SR-BI expression in a posttranscriptional fashion and is regulated by phosphorylation at Ser-509 , PDZK1IP1 operates through distinct mechanisms by interacting with Smad4 and regulating TGF-β signaling .

The coordination between PDZK1IP1 and other regulatory proteins involves:

  • Competitive binding dynamics: PDZK1IP1 may compete with R-Smads for binding to Smad4, creating a regulatory mechanism dependent on relative protein concentrations and affinities

  • Subcellular localization control: By retaining Smad4 in the cytoplasm, PDZK1IP1 affects the nuclear-cytoplasmic distribution of signaling components

  • Integration with other signaling pathways: The TGF-β pathway intersects with multiple other signaling cascades, suggesting PDZK1IP1 may indirectly affect other cellular processes

  • Tissue-specific regulatory networks: PDZK1IP1's effects may vary across different cell types depending on the expression levels of interacting proteins

Understanding these network interactions requires integrative approaches combining proteomics, transcriptomics, and functional studies. Future research should focus on mapping the complete interactome of PDZK1IP1 to fully understand its role within cellular signaling networks.

What are the challenges in translating PDZK1IP1 research findings to therapeutic applications?

Translating PDZK1IP1 research findings into therapeutic applications presents several significant challenges:

  • Context-dependent effects: TGF-β signaling can be both tumor-suppressive and tumor-promoting depending on the cancer type and stage . Therefore, modulating PDZK1IP1 might have unpredictable effects in different contexts.

  • Selectivity and specificity: Developing compounds that specifically target the PDZK1IP1-Smad4 interaction without affecting other PDZ domain interactions is technically challenging.

  • Delivery methods: Targeting PDZK1IP1 expression or function in specific tissues requires advanced delivery systems to avoid systemic effects.

  • Biomarker development: Identifying patient populations that would benefit from PDZK1IP1-targeted therapies requires reliable biomarkers of pathway activity.

  • Compensatory mechanisms: Cells may develop compensatory mechanisms that overcome PDZK1IP1-mediated regulation of TGF-β signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.