Recombinant Rat Peptidyl-prolyl cis-trans isomerase FKBP8 (Fkbp8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fkbp8; Peptidyl-prolyl cis-trans isomerase FKBP8; PPIase FKBP8; FK506-binding protein 8; FKBP-8; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Fkbp8
Target Protein Sequence
MASWAEPSEPAAQLLCGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPG ALAREFLAATEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPTGSSRPLKGQVVTVHLQMS LENGTRVQEEPELAFTLGDCDVIQALDLSVPLMHVGETAMVTADSKYCYGPQGSRSPYIP PHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIK AITSNAKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKAL FRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLG NPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Uniprot No.

Target Background

Function

Constitutively inactive peptidyl-prolyl cis-trans isomerase FKBP8 becomes active upon binding to calmodulin and calcium. It functions as a chaperone for BCL2, targeting it to the mitochondria and modulating its phosphorylation. The BCL2/FKBP8/calmodulin/calcium complex likely interferes with BCL2 binding to its targets. Therefore, the active form of FKBP8 may regulate apoptosis.

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is Rat Peptidyl-prolyl cis-trans isomerase FKBP8 and what are its primary functions?

FKBP8, also known as FK506-binding protein 8, is a peptidyl-prolyl cis-trans isomerase that plays crucial roles in protein folding, trafficking, and mitochondrial quality control. FKBP8 is constitutively inactive as a PPIase but becomes active when bound to calmodulin and calcium . It functions as a chaperone for BCL2, targeting it to mitochondria and modulating its phosphorylation state, with the BCL2/FKBP8/calmodulin/calcium complex interfering with BCL2 binding to its targets .

Beyond its chaperone function, FKBP8 serves as a mitophagy receptor that efficiently recruits lipidated LC3A to damaged mitochondria in a LIR-dependent manner . This interaction mediates Parkin-independent mitophagy, providing an alternative pathway for mitochondrial quality control . Additionally, FKBP8 participates in protein degradation pathways, directing certain substrates like DLK for ubiquitin-dependent degradation .

Where is FKBP8 predominantly localized in mammalian cells?

Immunostaining studies using anti-FKBP8 antibodies have revealed that FKBP8 displays a puncta-like distribution in cells, with approximately 88.2% of FKBP8 localized at mitochondria in HeLa cells . Specifically, FKBP8 is anchored in the outer mitochondrial membrane (OMM) through its transmembrane domain . This strategic positioning allows FKBP8 to interact with proteins from other organelles, particularly the endoplasmic reticulum (ER) .

Recent research has demonstrated that FKBP8 forms complexes with the ER-resident protein PDZD8 at mitochondria-ER contact sites (MERCS) . On mitochondria, the overlap between endogenous PDZD8 and FKBP8 (54.0%) is significantly higher compared to randomized controls (23.2%), indicating specific co-localization at these interorganelle junctions . This localization pattern is conserved across species, as confirmed in both human HeLa cells and mouse NIH3T3 cells using endogenous tagging approaches .

What are the key structural domains of FKBP8 and their specific functions?

FKBP8 contains several distinct domains that contribute to its diverse functions:

DomainLocationFunctionExperimental Evidence
Peptidylprolyl isomerase (PPI) domainCentral regionCatalyzes protein folding; mediates protein interactionsYeast-2-hybrid assays show PPI domain is essential for MLCK1 interaction
Tetratricopeptide (TPR) domainsC-terminal regionFacilitates protein-protein interactionsDeletion mutants retain MLCK1 binding capacity
Transmembrane (TM) domainC-terminusAnchors FKBP8 to mitochondrial membraneDeletion studies demonstrate TM domain is dispensable for some protein interactions
Glutamate (E) rich domain (ERD)N-terminusUnknown function, potentially regulatoryDeletion doesn't affect MLCK1 binding
LC3-interacting region (LIR) motifN-terminusBinds LC3/GABARAP proteins; essential for mitophagyMutations in LIR motif abolish binding to ATG8 proteins

Experimental approaches including yeast-2-hybrid assays, deletion mutant analysis, and co-immunoprecipitation studies have validated the functional significance of these domains . The PPI domain is particularly critical, as FKBP8 constructs lacking this domain fail to interact with MLCK1, while constructs lacking other domains maintain this interaction .

How does FKBP8 differ from other mitophagy receptors in structure and function?

FKBP8 possesses several distinctive features that differentiate it from other mitophagy receptors:

  • Escape from degradation: Unlike conventional mitophagy receptors (BNIP3, NIX) that are degraded along with mitochondria, FKBP8 avoids degradation by escaping from mitochondria during mitophagy . This unique property allows FKBP8 to participate in multiple rounds of mitophagy.

  • LC3A specificity: FKBP8 shows preferential binding to LC3A compared to other ATG8 family members. In vitro binding assays demonstrate strong interactions with LC3A, LC3B, GABARAP, and GABARAPL1, but very weak binding to LC3C and GABARAPL2 . In vivo, FKBP8 predominantly co-precipitates with LC3A, with weaker but significant co-precipitation of LC3B .

  • Activation mechanism: FKBP8 is constitutively inactive as a PPIase and requires binding to calmodulin and calcium to become active . This calcium-dependent regulation provides an additional layer of control not present in other mitophagy receptors.

  • Dual functionality: Beyond mitophagy, FKBP8 serves as a mitochondria-ER tethering protein through its interaction with PDZD8 . This interorganelle communication role is not a common feature of other mitophagy receptors.

  • Parkin independence: FKBP8-mediated mitophagy operates independently of the well-characterized PINK1/Parkin pathway, providing an alternative mechanism for mitochondrial quality control .

What are the established methods for measuring FKBP8 protein levels in rat tissue samples?

Several validated methods are available for quantifying FKBP8 protein levels in rat samples:

  • ELISA: Commercial rat FKBP8-specific ELISA kits offer a quantitative approach with:

    • Detection range: 0.312-20 ng/mL

    • Sensitivity: 0.098 ng/mL

    • Intra-assay CV: 4.2%

    • Inter-assay CV: 7.9%

    • Compatible with serum, plasma, and tissue homogenates

  • Western Blotting: For semi-quantitative analysis using anti-FKBP8 antibodies:

    • Sample preparation with CHAPS or RIPA buffer

    • Pre-clearing with protein A/G-agarose beads

    • Detection with specific antibodies via chemiluminescence

    • Quantification by densitometry relative to housekeeping proteins

  • Immunoprecipitation followed by immunoblotting:

    • Cell lysate preparation in CHAPS buffer

    • Incubation with anti-FKBP8 antibody overnight at 4°C

    • Precipitation with protein A/G-agarose beads

    • Washing and protein elution by boiling with SDS loading buffer

    • Western blot analysis with appropriate antibodies

  • Immunofluorescence microscopy:

    • Allows visualization of FKBP8 distribution in fixed tissues

    • Anti-FKBP8 antibodies reveal punctate distribution

    • Co-staining with mitochondrial markers (e.g., TOM20) enables localization analysis

    • Quantification of co-localization with other proteins is possible through image analysis

How can I effectively overexpress FKBP8 in rodent model systems?

Several approaches are available for FKBP8 overexpression in rodent models:

  • AAV-mediated gene delivery:

    • Pre-packaged AAV vectors expressing rat FKBP8 (1212 bp ORF) are commercially available

    • Multiple serotypes (AAV1, AAV2, AAV3, AAV5, AAV6, AAV8, AAV9, AAV-DJ, AAV-DJ8, AAV-DJ9) offer tissue-specific tropism

    • Default CMV promoter can be substituted with tissue-specific alternatives

    • Optional reporter genes (GFP, CFP, YFP, RFP, mCherry) allow expression tracking

    • Delivery routes include intravenous, intramuscular, or stereotaxic injection depending on target tissue

  • CRISPR/Cas9 knock-in approaches:

    • For tagging endogenous FKBP8 with fluorescent proteins or epitope tags

    • Enables visualization of physiologically relevant expression patterns

    • Has been successfully implemented in cell lines as demonstrated in FKBP8-PDZD8 interaction studies

    • Can be combined with dual knock-in strategies to simultaneously tag multiple proteins

  • In vitro recombinant protein production:

    • For biochemical and structural studies

    • Expression in E. coli systems with appropriate tags (His-tag, GST)

    • Purification via affinity chromatography

    • Has been successfully used to produce functional FKBP8 for interaction studies

What experimental approaches can verify direct protein-protein interactions with FKBP8?

Multiple complementary techniques have been validated for studying FKBP8's interactions with partner proteins:

  • Proximity Ligation Assay (PLA):

    • Detects protein interactions within 10 nm distance in situ

    • Successfully applied to study MLCK1-FKBP8 interactions

    • Can quantify changes in interaction frequency under different conditions (e.g., TNF stimulation increased MLCK1-FKBP8 interactions 3.1±0.1-fold)

    • Provides spatial information about interaction locations within cells

  • Yeast-2-hybrid assays:

    • Used to map domain-specific interactions

    • Applied to study FKBP8-MLCK1 interaction specificity

    • Demonstrated that MLCK1, but not MLCK2, interacts with FKBP8

    • Identified the PPI domain as critical for this interaction

  • GST-pulldown assays:

    • In vitro technique using purified recombinant proteins

    • Demonstrated for interactions between FKBP8 and ATG8 family proteins

    • Shows high-affinity binding toward GABARAPL1 and LC3A, low-affinity binding toward GABARAPL2 and LC3C, and intermediate-affinity binding toward LC3B and GABARAP

    • Used to confirm direct binding between PDZD8 and FKBP8

  • Co-immunoprecipitation:

    • Detects interactions in cellular contexts

    • GFP-tagged ATG8 proteins co-precipitated with Flag-tagged FKBP8

    • Confirmed preferential binding to LC3A in cellular environment

    • LIR mutant FKBP8 failed to co-precipitate ATG8 proteins

  • Surface Plasmon Resonance (SPR):

    • Measures binding kinetics and affinities in real-time

    • Used to study FKBP8-PDZD8 interactions

    • Provided KD value of 142 μM for PDZD8-FKBP8 interaction

    • Demonstrated concentration-dependent binding

What is the role of FKBP8 in mitochondrial quality control pathways?

FKBP8 plays multiple roles in mitochondrial quality control through several mechanisms:

  • Mitophagy receptor function:

    • Contains an N-terminal LIR motif that binds LC3A with high affinity

    • Efficiently recruits lipidated LC3A to damaged mitochondria

    • Mediates Parkin-independent mitophagy

    • Co-expression of FKBP8 with LC3A profoundly induces mitophagy

  • Selective escape from degradation:

    • Unlike conventional mitophagy receptors, FKBP8 avoids degradation during mitophagy

    • This enables FKBP8 to participate in multiple rounds of mitophagy

    • May serve as a mechanism to preserve this critical quality control factor

  • Response to oxidative stress:

    • FKBP8 mediates mitophagy in response to paraquat-induced oxidative stress

    • Normal trafficking of FKBP8 to the endoplasmic reticulum occurs during oxidative stress

    • This trafficking is disrupted by disease-relevant phosphorylated tau

  • Interaction with disease mechanisms:

    • Phosphomimetic tau mutants (EC at Ser-396/404 or EM at Thr-231/Ser-235) inhibit oxidative stress-induced mitophagy

    • This inhibition correlates with decreased FKBP8 levels

    • Provides a link between tau pathology and mitochondrial dysfunction in neurodegenerative diseases

  • Cell type and stressor specificity:

    • FKBP8's role varies across cell types and stress conditions

    • Knockdown suppresses hypoxia- and iron deficiency-induced mitophagy in HeLa cells and human fibroblasts

    • Has minimal effect on CCCP-induced mitophagy in H9c2 myocytes and HEK293 cells

How does FKBP8 contribute to mitochondria-ER contact site formation?

FKBP8 plays a crucial role in forming and maintaining mitochondria-ER contact sites (MERCS) through its interaction with PDZD8:

  • Direct tethering complex:

    • FKBP8 localizes to the outer mitochondrial membrane

    • PDZD8 resides in the ER membrane

    • Their direct interaction forms a tethering complex between these organelles

    • This tethering occurs in trans, with proteins on opposing membranes

  • Domain-specific interaction:

    • The SMP-C2n-PDZ domain of PDZD8 directly binds to FKBP8

    • This was demonstrated using purified recombinant proteins

    • GST-pulldown assays confirm that FKBP8 is isolated only when incubated with GST-PDZD8

  • Interaction kinetics:

    • Surface plasmon resonance measurements revealed a KD value of 142 μM

    • This moderate affinity is consistent with dynamic exchange at contact sites

    • Similar to affinity ranges observed in other MERCS tethering complexes like VAPB-PTPIP51

  • Spatial organization:

    • 54.0% of PDZD8 and FKBP8 puncta overlap on mitochondria

    • This is significantly higher than scrambled controls (23.2%)

    • PDZD8 puncta are enriched on FKBP8-positive areas of mitochondria

    • This pattern is conserved across human and mouse cells

  • Functional significance:

    • MERCS are critical for calcium signaling, lipid transfer, and mitochondrial dynamics

    • The PDZD8-FKBP8 complex is required for MERCS formation in metazoan cells

    • Represents a conserved mechanism for interorganelle communication

What are the molecular mechanisms by which phosphorylated tau affects FKBP8-mediated mitophagy?

Phosphorylated tau impacts FKBP8-mediated mitophagy through several interconnected mechanisms:

  • Alteration of FKBP8 protein levels:

    • Phosphomimetic tau mutants (EC at Ser-396/404 or EM at Thr-231/Ser-235) cause decreased FKBP8 levels during oxidative stress

    • This decrease is not observed with wildtype tau

    • The effect is specific to FKBP8, as other mitophagy receptors (FUNDC1, BNIP3) show decreased levels with both wildtype and mutant tau

  • Disruption of FKBP8 trafficking:

    • FKBP8 normally traffics to the endoplasmic reticulum during oxidative stress-induced mitophagy

    • Phosphomimetic tau appears to disrupt this trafficking process

    • This may prevent FKBP8 from escaping degradation or performing its functions at the ER

  • Inhibition of mitophagy:

    • Phosphomimetic tau partly inhibits mitophagy induction by paraquat

    • This inhibition correlates with decreased FKBP8 levels

    • Provides a mechanistic link between tau pathology and mitochondrial dysfunction

    • May contribute to the mitochondrial abnormalities observed in Alzheimer's disease

  • Potential direct interaction:

    • Evidence suggests a possible direct interaction between tau and FKBP8

    • This interaction could interfere with FKBP8's ability to bind to LC3A or other mitophagy machinery

    • The model supports that tau pathology impacts FKBP8 trafficking, perhaps through direct interaction

How can contradictory findings about FKBP8's function in different cell types be reconciled?

Contradictory findings regarding FKBP8's function across cell types can be addressed through several approaches:

  • Stressor-specific responses:

    • Different stressors engage distinct mitophagy pathways even within the same cell type

    • Hypoxia and iron deficiency-induced mitophagy were suppressed by FKBP8 knockdown in HeLa cells and human fibroblasts

    • CCCP-induced mitophagy showed no effect with FKBP8 knockdown in H9c2 myocytes or HEK293 cells

    • Standardizing experimental conditions (stressor type, concentration, duration) is essential

  • Compensatory mechanisms:

    • FKBP8 knockdown may trigger alternative mitophagy pathways

    • Studies in Drosophila and HeLa cells demonstrated that MUL1 can mediate mitophagy in PINK1/Parkin absence

    • In C. elegans, knockdown of mitophagy factors leads to upregulation of stress response transcription factors

    • PINK1-PRKN knockout mice show evidence of compensatory mitophagy responses

  • Cell type-specific cofactors:

    • FKBP8 function may depend on cell type-specific interaction partners

    • Systematic analysis of the FKBP8 interactome across cell types could identify critical differences

    • Expression profiles of mitophagy machinery components may vary between cell types

    • Controlling for genetic background is crucial when comparing results across cell lines

  • Methodological standardization:

    • Different mitophagy measurement techniques can yield inconsistent results

    • Combining multiple complementary methods within the same study enhances reliability

    • Using both genetic and pharmacological approaches provides validation

    • Time-course experiments capture dynamic responses that may be missed at single timepoints

What are potential therapeutic approaches targeting FKBP8 in neurodegenerative conditions?

FKBP8 represents a promising therapeutic target for neurodegenerative conditions, with several potential approaches:

  • Enhancing FKBP8 stability:

    • Develop compounds that prevent the decrease in FKBP8 levels caused by phosphorylated tau

    • Screen for molecules that stabilize FKBP8 protein under disease conditions

    • Target the pathways responsible for FKBP8 degradation in the presence of phosphorylated tau

  • Promoting FKBP8-LC3A interaction:

    • Design peptide mimetics or small molecules that enhance the interaction between FKBP8 and LC3A

    • Focus on the N-terminal LIR motif that mediates this interaction

    • This approach could boost mitophagy efficiency even with reduced FKBP8 levels

  • Restoring FKBP8 trafficking:

    • Develop strategies to counter the trafficking disruption caused by phosphorylated tau

    • Identify the mechanisms by which FKBP8 normally escapes to the ER during mitophagy

    • Target these pathways to ensure proper FKBP8 redistribution under disease conditions

  • Gene therapy approaches:

    • AAV-mediated overexpression of FKBP8 could compensate for decreased protein levels

    • Multiple AAV serotypes provide options for targeting specific brain regions

    • Can be combined with tissue-specific promoters for precise expression patterns

    • May be delivered through various routes depending on the target tissue

  • Targeting compensatory pathways:

    • Upregulate alternative mitophagy receptors or pathways to bypass FKBP8 deficiency

    • Identify and enhance compensatory mechanisms that naturally occur in response to FKBP8 depletion

    • This approach leverages the redundancy in mitochondrial quality control systems

What experimental considerations are important when using recombinant FKBP8 for in vitro studies?

When using recombinant FKBP8 for in vitro studies, several important considerations should be addressed:

  • Expression and purification strategy:

    • Recombinant FKBP8 has been successfully expressed in E. coli systems

    • For mitochondrial membrane proteins like FKBP8, deletion of the transmembrane domain (ΔTM) improves solubility

    • Affinity tags (His-tag, GST) facilitate purification

    • Purification via TALON affinity columns or GST-binding beads has been validated

  • Activation considerations:

    • FKBP8 is constitutively inactive as a PPIase but becomes active when bound to calmodulin and calcium

    • For functional studies, including calmodulin and calcium in the reaction buffer may be necessary

    • Controlling calcium concentrations can provide a mechanism to regulate activity in vitro

  • Interaction assays:

    • Surface plasmon resonance has been used successfully to measure FKBP8 interactions

    • Protein binding assays using purified components can confirm direct interactions

    • GST-pulldown assays with recombinant proteins have demonstrated binding to partners like PDZD8

    • These approaches require careful buffer optimization to maintain protein stability

  • Functional domains:

    • For interaction studies, consider which domains are essential for specific functions

    • The PPI domain is critical for interactions with proteins like MLCK1

    • The N-terminal LIR motif is essential for LC3A binding

    • Domain-specific mutants can help dissect precise interaction requirements

  • Species considerations:

    • Human and mouse FKBP8 have been shown to associate with some of the same partners (e.g., DLK)

    • When combining components from different species, verify functional compatibility

    • For rat FKBP8 specifically, validation against human or mouse orthologs may be necessary

What are the emerging areas of FKBP8 research with therapeutic potential?

Several promising research directions could expand FKBP8's therapeutic applications:

  • FKBP8 in inflammatory disorders:

    • FKBP8 interacts with MLCK1 to regulate barrier function in intestinal epithelial cells

    • TNF stimulation increases FKBP8-MLCK1 interactions 3.1±0.1-fold

    • This pathway represents a potential therapeutic target in Crohn's disease

    • Further investigation into FKBP8's role in other inflammatory conditions is warranted

  • Mitophagy enhancement strategies:

    • FKBP8's ability to mediate Parkin-independent mitophagy offers a parallel pathway for mitochondrial quality control

    • This could be particularly valuable in diseases with compromised PINK1/Parkin function

    • Developing compounds that enhance FKBP8-mediated mitophagy could benefit multiple neurodegenerative conditions

  • Interorganelle communication modulation:

    • The FKBP8-PDZD8 interaction at mitochondria-ER contact sites represents a druggable interface

    • Modulating this interaction could affect calcium signaling, lipid transfer, and mitochondrial dynamics

    • This approach might be relevant for metabolic disorders and neurodegenerative diseases

  • Protein degradation pathways:

    • FKBP8's role in directing proteins like DLK for degradation suggests potential in manipulating protein turnover

    • This could be applied to conditions with toxic protein accumulation

    • Understanding the specificity of FKBP8-mediated degradation could enable targeted therapeutic approaches

  • Tau-FKBP8 interaction in Alzheimer's disease:

    • The disruption of FKBP8-mediated mitophagy by phosphorylated tau provides a novel link between tau pathology and mitochondrial dysfunction

    • Preventing this disruption could preserve mitochondrial quality control in Alzheimer's disease

    • This approach offers a new avenue distinct from direct tau-targeting strategies

What methodological advances would advance FKBP8 research?

Several methodological advances could significantly enhance FKBP8 research:

  • Live-cell imaging of FKBP8 dynamics:

    • Development of non-disruptive tagging strategies for endogenous FKBP8

    • Application of super-resolution microscopy to visualize FKBP8 at mitochondria-ER contact sites

    • Live tracking of FKBP8 trafficking during mitophagy

    • CRISPR knock-in approaches have already demonstrated feasibility for tagging endogenous FKBP8

  • Structural biology approaches:

    • Cryo-EM structures of FKBP8 in complex with interaction partners

    • Detailed structural information about FKBP8-LC3A and FKBP8-PDZD8 interfaces

    • Structural basis for FKBP8's escape from degradation during mitophagy

    • These insights would facilitate structure-based drug design

  • Single-molecule techniques:

    • Single-molecule tracking has already revealed dynamic properties of PDZD8-FKBP8 interactions

    • Further application to study FKBP8 behavior under different stress conditions

    • Combining with optogenetics to control FKBP8 activity with spatiotemporal precision

    • These approaches could reveal mechanisms that are masked in bulk measurements

  • Systems biology integration:

    • Multi-omics profiling to understand FKBP8's position in cellular networks

    • Computational modeling of FKBP8-mediated pathways across different cell types

    • Network analysis to identify critical nodes that influence FKBP8 function

    • These integrative approaches could reconcile contradictory findings in different experimental systems

  • In vivo models with conditional FKBP8 modulation:

    • Development of tissue-specific and temporally controlled FKBP8 knockout or overexpression models

    • Application in disease models to assess therapeutic potential

    • Use of AAV vectors with different serotypes for targeted delivery

    • These models would bridge the gap between cellular studies and clinical applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.