Recombinant Rat Peripheral myelin protein 22 (Pmp22)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Myelin Biology

Pmp22 is essential for Schwann cell growth, peripheral myelin compaction, and protection against mechanical stress . Key findings include:

  • Myelin Stability: Forms complexes with Myelin Protein Zero (MPZ/P0) to maintain compact myelin structure .

  • Disease Links: Overexpression or mutations cause Charcot-Marie-Tooth disease (CMT1A) and hereditary neuropathy with liability to pressure palsies (HNPP) .

  • Aggregation Propensity: Misfolded PMP22 forms aggresomes linked to neuropathies, with autophagy playing a role in clearance .

Table 2: Functional Comparisons

FeatureWild-Type PMP22Recombinant PMP22
Expression SystemSchwann cellsE. coli
Glycosylation StatusN-linked glycosylation at Asn41 Non-glycosylated
Phase PartitioningPrefers ordered membrane domains Not tested in lipid bilayers
Disease Modeling UtilityUsed in transgenic neuropathy models Used for in vitro binding assays

3.1. Mechanistic Studies

  • Protein-Protein Interactions: Coimmunoprecipitation studies demonstrate PMP22-MPZ complex formation, crucial for myelin adhesion .

  • Membrane Dynamics: PMP22 preferentially partitions into cholesterol-rich ordered membrane domains, a property disrupted by disease mutations like L16P .

3.2. Therapeutic Development

  • CMT1A Models: Reducing PMP22 levels via miR-29a mitigates mitotic deficits in patient-derived fibroblasts .

  • Aggresome Clearance: Autophagy enhancers (e.g., geldanamycin) reduce PMP22 aggregate formation in Schwann cells .

Quality Control and Usage

  • Activity Validation: Binding assays (e.g., functional ELISA) confirm biological activity .

  • Storage: Stable at -80°C in PBS (pH 7.4) with 10% glycerol .

  • Applications:

    • Western blotting (WB)

    • Immunoprecipitation (IP)

    • In vitro myelination assays

Limitations and Future Directions

  • Lack of Post-Translational Modifications: Recombinant PMP22 lacks native glycosylation, limiting studies on its role in membrane trafficking .

  • Structural Studies: Further work is needed to resolve its full tertiary structure and lipid interactions .

Product Specs

Buffer
If the delivery form is liquid, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Note: If you have specific requirements for the glycerol content, please indicate them when placing your order.
If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.

Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format currently in stock. However, if you have any specific requirements for the format, please specify them when placing your order. We will prepare the product according to your requirements.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Pmp22; Cd25; Pmp-22; Peripheral myelin protein 22; PMP-22; Protein CD25; SR13 myelin protein; Schwann cell membrane glycoprotein; SAG
Datasheet & Coa
Please contact us to get it.
Expression Region
1-160aa
Mol. Weight
23.4 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Rattus norvegicus (Rat)
Target Names
Pmp22
Target Protein Sequence
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Peripheral myelin protein 22 (PMP22) is a protein that in humans is encoded by the PMP22 gene. It is involved in the formation and maintenance of the myelin sheath, a fatty layer that insulates nerve fibers and allows for rapid signal transmission. PMP22 is thought to play a role in growth regulation and myelination in the peripheral nervous system.
Gene References Into Functions
  1. Increased PMP22 protein expression and morphological improvements have been observed alongside the elimination of thermal and mechanical hypersensitivity and pain relief following crush injury of a myelinated peripheral nerve. PMID: 22190549
  2. Both functions of PMP22, in regulating Schwann cell differentiation and contributing to peripheral myelin compaction, are impacted by its overexpression. PMID: 11456309
  3. Gas3/PMP22 levels can influence membrane traffic of the Arf6 plasma-membrane-endosomal recycling pathway and demonstrate that, similar to other tetraspan proteins, Gas3/PMP22 can accumulate in late endosomes. PMID: 12584243
  4. During the early stages of myelination, PMP22 and beta4 integrin are coexpressed on the DRG cell surface and can be coimmunoprecipitated along with laminin and alpha6 integrin. PMID: 16436605
  5. miR-29a represses expression of PMP22. Analyses of miR-29 and PMP22 in sciatic nerves reveal an inverse relationship, both developmentally and in post-crush injury. PMP22 has been identified as a target of miRNAs, suggesting that miRNAs regulate Schwann cell myelin expression. PMID: 19170179

Show More

Hide All

Database Links

KEGG: rno:24660

STRING: 10116.ENSRNOP00000051201

UniGene: Rn.1476

Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).

Q&A

What is the molecular structure of rat PMP22?

Rat PMP22 is an integral membrane glycoprotein with four transmembrane-spanning domains, two extracellular loops (ECL1 and ECL2), and one intracellular domain. The protein has a molecular weight of approximately 22 kDa. The first extracellular loop (ECL1) mediates homophilic trans-interactions between PMP22 proteins, while the second extracellular loop (ECL2) facilitates heterophilic trans-interactions with myelin protein zero . The coding region of PMP22 spans from exon-2 to exon-5, with specific exons encoding distinct structural elements: exon-2 encodes the first transmembrane domain, exon-3 encodes the first extracellular loop, exon-4 encodes the second transmembrane domain and half of the third transmembrane domain, and exon-5 encodes the remaining structural elements .

How does rat PMP22 contribute to peripheral nerve function?

PMP22 plays essential roles in multiple aspects of peripheral nerve biology. It regulates the formation of tight adherens and adhesion junctions in peripheral myelin, which are critical for myelin compaction and structural integrity . Deficiency in PMP22 disrupts these junctions, resulting in leaky myelin and impaired action potential propagation . Additionally, PMP22 shows homology to proteins associated with ion channel modulation, particularly store-operated calcium (SOC) channels composed of Orai1 and STIM1 . Recent evidence suggests PMP22 may be involved in regulating growth arrest, apoptosis, and linking the actin-cytoskeleton to lipid rafts, although some of these functions remain controversial .

What are the primary research models for studying rat PMP22?

Several transgenic rodent models have been developed to study PMP22 function and pathology. The "CMT rat" model was generated by pronuclear injection of a cosmid-derived 43 kb DNA fragment harboring the entire murine Pmp22 gene, resulting in approximately 3 additional copies of the genomic fragment . This model demonstrates PMP22 overexpression at 1.6-fold normal levels when quantified by real-time RT-PCR, which closely mimics human CMT1A pathology . Other models include transgenic mice with varying degrees of PMP22 overexpression, correlating with disease severity . These animal models have been instrumental in understanding that the clinical phenotype correlates with PMP22 transcription levels rather than nominal transgene copy number .

What expression systems are most effective for recombinant rat PMP22 production?

The methylotrophic yeast Pichia pastoris has proven to be an effective host for overexpression of rat PMP22 (rPMP22) . This system allows for robust protein production while maintaining proper folding of membrane proteins. Using P. pastoris, researchers have achieved significant yields of rPMP22, with fed-batch fermentation yielding approximately 90 mg of rPMP22 protein from 4L of culture . Unlike traditional expression systems, P. pastoris directs rPMP22 to membrane compartments such as the nuclear envelope rather than peroxisomal membranes, which helps maintain protein stability .

What purification strategy yields high-quality recombinant rat PMP22?

A two-step purification process has been developed to obtain highly pure rPMP22. This approach preserves the functional structure of the protein as confirmed by several physicochemical assays . Traditional attempts to purify PMP22 from bovine peripheral nerves were laborious and yielded insufficient concentration and purity for structural analyses . The optimized recombinant approach using P. pastoris circumvents these limitations, providing sufficient quantities of functionally intact protein for comprehensive biochemical and structural studies .

How can researchers verify the structural integrity of purified recombinant rat PMP22?

Multiple physicochemical assays should be employed to assess the structural integrity of purified rPMP22. These include circular dichroism spectroscopy to confirm secondary structure elements, size-exclusion chromatography to evaluate oligomeric state, and thermal stability assays to assess protein folding . Additionally, functional assays examining PMP22's ability to interact with known binding partners can provide evidence of proper folding. Immunological detection using conformation-specific antibodies that recognize native epitopes can further validate structural integrity .

How can recombinant rat PMP22 be utilized to study calcium channel modulation?

Recombinant rat PMP22 can be used to investigate its putative role in modulating store-operated calcium (SOC) channels. Researchers can employ electrophysiological techniques to measure changes in membrane conductance in cells expressing PMP22_WT compared to controls . Calcium imaging experiments can be performed using fluorescent calcium indicators to quantify changes in intracellular calcium levels following store depletion in the presence or absence of PMP22. Co-immunoprecipitation and proximity ligation assays can be used to examine physical interactions between PMP22 and SOC channel components (Orai1 and STIM1) . These approaches can help elucidate the mechanistic basis of PMP22's involvement in calcium homeostasis.

What experimental approaches best reveal PMP22 interactions with other myelin proteins?

Several complementary techniques can be employed to study PMP22 interactions:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationDetection of stable protein-protein interactionsCaptures physiological interactionsMay miss transient interactions
Proximity ligation assayIn situ visualization of protein interactionsSingle-molecule sensitivityRequires specific antibodies
FRET/BRETReal-time monitoring of interactionsDetects dynamic interactionsRequires protein tagging
Cross-linking mass spectrometryIdentification of interaction interfacesProvides structural informationComplex data analysis
Split-reporter assaysValidation of direct interactionsHigh specificityPotential for false negatives

These approaches have revealed that PMP22's ECL1 mediates homophilic trans-interactions between PMP22 proteins, while ECL2 facilitates heterophilic trans-interactions with myelin protein zero, providing insights into how PMP22 contributes to myelin compaction and stability .

How can researchers use recombinant PMP22 to investigate pathogenic mechanisms in CMT1A?

Recombinant PMP22 can be engineered to carry disease-associated mutations for comparative functional studies against wild-type protein. Researchers can examine protein folding, trafficking, and stability differences between wild-type and mutant forms using pulse-chase experiments, immunofluorescence microscopy, and biochemical stability assays . Cell-based assays can assess the impact of PMP22 mutations on intracellular calcium dynamics, growth arrest, and apoptosis . Additionally, the recombinant protein can be incorporated into liposomes or nanodiscs to study how mutations affect membrane properties and protein-lipid interactions. These in vitro approaches complement transgenic animal models and provide mechanistic insights into how PMP22 alterations lead to disease phenotypes .

How can researchers overcome aggregation issues with recombinant PMP22?

PMP22 aggregation during recombinant expression and purification presents a significant challenge, particularly with disease-associated mutants like L16P that cause protein misfolding . To mitigate aggregation:

  • Optimize detergent selection for solubilization and purification, testing mild non-ionic detergents (DDM, LMNG) or lipid-like detergents (CHAPS, digitonin).

  • Include stabilizing agents such as glycerol (10-20%) or specific lipids (cholesterol, sphingomyelin) that reflect the native myelin environment.

  • Maintain strict temperature control throughout purification, typically using reduced temperatures (4°C).

  • Consider fusion tags that enhance solubility (SUMO, MBP) with cleavable linkers.

  • Utilize nanodiscs or styrene-maleic acid lipid particles (SMALPs) to provide a more native-like membrane environment .

These approaches have significantly improved the yield of correctly folded recombinant PMP22 suitable for functional and structural studies.

What controls are essential when studying PMP22 overexpression in experimental models?

When investigating PMP22 overexpression effects, several controls are critical:

  • Quantify actual PMP22 mRNA levels by real-time RT-PCR rather than relying solely on gene copy number, as transcriptional regulation may not correlate directly with gene dosage .

  • Include wild-type controls alongside transgenic models to establish baseline parameters.

  • Implement dosage-dependent controls with varying levels of PMP22 expression to establish dose-response relationships.

  • Use age-matched controls to account for developmental changes, as PMP22-related phenotypes can progress over time .

  • Consider inducible expression systems (e.g., tetracycline-controlled transactivation) to distinguish between developmental and acute effects of PMP22 overexpression .

The CMT rat model demonstrates that a 1.6-fold increase in PMP22 transcription (rather than the 3-fold increase in gene copy number) correlates with disease phenotypes, highlighting the importance of precise expression level quantification .

What are the latest insights into PMP22 structure-function relationships?

Recent advances in membrane protein biochemistry have enhanced our understanding of PMP22 structure-function relationships. While early efforts to purify PMP22 from bovine sources were challenging , newer approaches using recombinant expression in P. pastoris have yielded sufficient quantities of properly folded protein for detailed analyses . These studies have revealed that PMP22 shares structural homology with claudins and likely adopts a similar folding pattern . The four-transmembrane topology with two extracellular loops has functional significance: ECL1 mediates homophilic interactions between PMP22 molecules, while ECL2 facilitates heterophilic interactions with myelin protein zero . These structural insights help explain how PMP22 contributes to myelin compaction and the formation of tight junctions necessary for proper nerve conduction .

How are therapeutic approaches targeting PMP22 in CMT disease models evolving?

Therapeutic strategies targeting PMP22 in CMT disease models have shown promising results. In proof-of-principle studies using the CMT rat model, synthetic antagonists of the nuclear progesterone receptor reduced PMP22 overexpression, presenting a potential pharmacological approach to treating CMT1A . Inducible transgenic models have demonstrated that PMP22-dependent demyelination is reversible when overexpression is turned off, suggesting that therapies reducing PMP22 expression might be effective even after disease onset . This finding has crucial implications for translational research aimed at pharmacologically reducing PMP22 overexpression .

Current therapeutic research focuses on:

  • Transcriptional regulators that modulate PMP22 expression, including EGR2, Sox10, and Oct6

  • Small molecules that promote proper folding of mutant PMP22

  • Compounds that enhance degradation of misfolded PMP22

  • Gene therapy approaches to normalize PMP22 expression levels

These approaches represent promising avenues for treating CMT1A and related neuropathies caused by PMP22 abnormalities.

What experimental models best recapitulate human PMP22-related neuropathies?

The most clinically relevant models for studying PMP22-related neuropathies are transgenic rodents with controlled PMP22 expression levels . The CMT rat model, generated through pronuclear injection of a cosmid-derived 43 kb DNA fragment containing the entire murine Pmp22 gene, demonstrates a 1.6-fold increase in PMP22 expression that closely mimics human CMT1A pathology . These rats exhibit progressive demyelination, onion bulb formation, and motor deficits that can be quantitatively assessed using behavioral tests (bar test, rotarod, grip strength analysis) . Importantly, the severity of the clinical phenotype correlates with PMP22 transcription levels rather than gene copy number .

More severe phenotypes resembling Dejerine-Sottas syndrome or congenital hypomyelination can be modeled in rodents with higher PMP22 expression levels . Additionally, inducible models with tetracycline-controlled PMP22 expression have provided valuable insights into the reversibility of PMP22-dependent pathology . These models serve as platforms for testing therapeutic interventions and studying disease mechanisms at molecular, cellular, and systemic levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.