Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pex3; Peroxisomal biogenesis factor 3; Peroxin-3; Peroxisomal assembly protein PEX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pex3
Target Protein Sequence
MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKLREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTSILAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSISLKHSLSLLDLEQKLKEIRTLVEQHRSCWNDKDASKSSLCHYMMPD EETPLAAQAYGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK
Uniprot No.

Target Background

Function
Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3) is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles prior to matrix protein translocation and acts as a docking factor for PEX19, essential for importing peroxisomal membrane proteins into peroxisomes.
Database Links
Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of rat Pex3 protein?

Rat Pex3 is a 372-amino-acid integral membrane protein of peroxisomes. Its structure features both N- and C-terminal domains exposed to the cytosol, with a membrane-spanning region that anchors it firmly to the peroxisomal membrane . The protein shows high conservation across species, with human and Chinese hamster Pex3p demonstrating 96% and 94% identity to rat Pex3p, respectively, though the human version contains 373 amino acids . The protein's N-terminal segment (residues 1-40) contains the minimal peroxisomal targeting information, sufficient to direct fusion proteins to peroxisomes, while the full-length protein is required for complete peroxisome-restoring activity .

How does Pex3 function in peroxisome membrane assembly?

Pex3 initiates membrane assembly in peroxisome biogenesis by targeting to discrete ER-localized punctae to form a dynamic ER subcompartment that eventually develops into mature peroxisomes . Mechanistically, Pex3 functions as a docking site for Pex19p, which acts as a receptor/chaperone for peroxisomal membrane proteins (PMPs) . This Pex3-Pex19 interaction is essential for the early stages of peroxisomal membrane vesicle formation, as evidenced by studies showing that peroxisomal membrane vesicles form prior to matrix protein import in cells expressing recombinant Pex3 . Cells lacking functional Pex3 are not only devoid of mature peroxisomes but also lack peroxisomal remnants (ghosts), confirming its fundamental role in initiating membrane biogenesis .

What experimental evidence confirms Pex3's membrane integration?

To confirm Pex3's membrane integration, researchers typically employ subcellular fractionation followed by biochemical extraction protocols. In studies with tagged Pex3 proteins (such as Pex3Bp-mRFP), the protein localizes almost exclusively to the membrane pellet fraction after hypotonic lysis and centrifugation, similar to known peroxisomal integral membrane proteins like Pex2p . Unlike soluble peroxisomal matrix enzymes (e.g., Pot1p), which appear in the supernatant fraction, Pex3 resists extraction with alkali sodium carbonate treatment - a classic characteristic of integral membrane proteins rather than peripherally associated ones . This differential fractionation pattern provides definitive evidence for Pex3's integration into the peroxisomal membrane.

How does Pex3 interact with Pex19p at the molecular level?

Pex3 serves as a peroxisomal receptor for Pex19p through direct protein-protein interaction . Studies have demonstrated that Pex3p specifically binds the farnesylated form of Pex19p, suggesting post-translational modification influences this critical interaction . The binding interface likely involves specific domains that recognize the structural features of farnesylated Pex19p, creating a selective recruitment mechanism. This interaction forms the foundational complex that enables subsequent recruitment of other peroxisomal membrane proteins. For experimental investigation of this interaction, researchers commonly employ co-immunoprecipitation assays, yeast two-hybrid systems, and fluorescence resonance energy transfer (FRET) analyses to map the precise binding domains and quantify interaction affinities between recombinant Pex3 and Pex19 variants.

What is the unexpected role of Pex3 in peroxisome inheritance?

Beyond its established role in peroxisome biogenesis, Pex3 functions surprisingly as a key factor in peroxisome inheritance during cell division . Mechanistically, Pex3 and its paralogue Pex3Bp (in organisms like Yarrowia lipolytica) serve as peroxisomal receptors for class V myosin through direct interaction with the myosin globular tail . This interaction creates a molecular tether that connects peroxisomes to the cellular motility machinery. In cells lacking Pex3Bp, peroxisomes are preferentially retained by mother cells, whereas overexpression of either Pex3p or Pex3Bp causes most peroxisomes to gather and transfer en masse to daughter cells (buds in yeast) . This finding establishes a temporal link between peroxisome formation and inheritance, suggesting a coordinated mechanism to ensure proper organelle distribution during cell division.

How does Pex3 deficiency affect peroxisome morphology and function?

Deletion or mutation of the PEX3 gene dramatically impacts peroxisome structure and function. In knockout models, cells exhibit either complete absence of peroxisomes or severely abnormal peroxisomal morphology . Specifically, in Pex3BΔ cells (with deletion of the Pex3Bp paralogue), peroxisomes become hyperelongated and tubular-reticular in appearance, suggesting an imbalance between peroxisome growth and fission . The percentage of cells containing these abnormal elongated peroxisomes increases over time (>90% after 10 hours in oleic acid medium) . Functionally, Pex3 deficiency disrupts peroxisomal metabolism, leading to significant reactive oxygen species (ROS) accumulation. Measurements using dihydroethidium fluorescence and malondialdehyde levels in Pex3-KO mice show significantly elevated ROS and increased expression of γH2X (a marker of DNA damage) . These disruptions contribute to broader cellular dysfunction, including impaired cardiomyocyte proliferation in cardiac models.

What are optimal expression systems for producing recombinant rat Pex3?

Producing functional recombinant rat Pex3 presents significant challenges due to its membrane-integrated nature. The most successful expression systems employ eukaryotic hosts (rather than prokaryotic systems) to ensure proper folding and post-translational modifications. For research applications, mammalian cell lines (HEK293, CHO) and yeast systems (particularly Pichia pastoris) have proven effective. The expression construct should include:

  • Strong but regulatable promoters (e.g., CMV for mammalian cells, AOX1 for Pichia)

  • Appropriate signal sequences to ensure membrane targeting

  • Affinity tags (His, FLAG) positioned to avoid interference with membrane insertion

  • Codon optimization for the host organism

To enhance solubility and stability, researchers often employ fusion partners such as MBP (maltose-binding protein) or truncated versions that retain functional domains while eliminating hydrophobic segments. For verification of proper expression, Western blotting targeting either the native protein or fusion tags, combined with subcellular fractionation to confirm membrane localization, is essential.

How can researchers generate and validate Pex3 knockout models?

Generating Pex3 knockout models requires careful planning due to the protein's essential role in peroxisome formation. Contemporary approaches include:

Knockout StrategyAdvantagesLimitationsValidation Methods
CRISPR/Cas9Precise targeting, efficientPotential off-target effectsPCR genotyping, Western blot
Conditional KO (Cre-loxP)Tissue-specific deletion, timed inductionMore complex designCre expression confirmation, tissue-specific PCR
siRNA/shRNARapid implementation, tunableIncomplete knockdownqRT-PCR, western blot
TALENsHigh specificityLabor intensiveSequencing, protein detection

For validation of Pex3 knockout, researchers should employ multiple complementary approaches, as demonstrated in studies of Pex3-KO mice . These include:

  • Molecular validation: qRT-PCR and Western blot analysis to confirm absence of Pex3 mRNA and protein

  • Cellular validation: Immunofluorescence staining of peroxisomal markers (e.g., catalase, PMP70) to confirm absence of peroxisomes or altered morphology

  • Ultrastructural validation: Transmission electron microscopy to directly visualize peroxisome abnormalities

  • Functional validation: Biochemical assays for peroxisomal metabolic activities and ROS accumulation (DHE fluorescence, MDA levels)

What complementation assays confirm Pex3 functionality?

Complementation assays provide crucial evidence for Pex3 functionality and have been instrumental in understanding peroxisome biogenesis disorders. The gold standard approach utilizes cells from defined complementation groups with known Pex3 deficiencies. When conducting these assays:

  • Express wild-type or mutant recombinant Pex3 constructs in Pex3-deficient cells (e.g., ZPG208 CHO mutant from complementation group 17 )

  • Assess restoration of peroxisome formation using immunofluorescence for peroxisomal markers (e.g., catalase, PMP70)

  • Evaluate peroxisomal protein import by monitoring localization of matrix proteins with PTS1/PTS2 targeting signals

  • Confirm membrane vesicle formation as an early indicator of functional complementation

In successful complementation, expression of wild-type HsPEX3 restores peroxisome biogenesis and protein import in mutant cells, while non-functional mutants (like flag-PEX3 delEx11) fail to restore these functions . Time-course experiments following complementation reveal that peroxisomal membrane vesicles form prior to matrix protein import, confirming Pex3's primary role in early peroxisome assembly .

How does Pex3 contribute to cardiac regeneration?

Recent studies have revealed an unexpected role for Pex3 in cardiac regenerative repair. In cardiomyocyte-specific Pex3 knockout mice (Pex3-KO), endogenous myocardial proliferation capacity is significantly reduced compared to wild-type mice . The mechanisms appear to involve:

  • Regulation of cardiomyocyte cell cycle: Ki67, pH3, EdU, and Aurora B assays demonstrate reduced proliferation markers in Pex3-KO cardiac tissues

  • Maintenance of mononucleated cardiomyocyte populations: Pex3 knockdown decreases the proportion of mononucleated cardiomyocytes while increasing binucleated cardiomyocytes

  • Protection against ROS-mediated damage: Pex3 deficiency leads to peroxisomal dysfunction, increased ROS (measured by DHE fluorescence), elevated lipid peroxidation (MDA levels), and DNA damage (γH2X expression)

Following apical resection (AR) injury in neonatal mice, Pex3-KO animals exhibit significantly lower myocardial proliferation signals in the injury area compared to wild-type mice, demonstrating that Pex3 is indispensable for myocardial regeneration after injury . This suggests therapeutic potential for Pex3-based interventions in cardiac regenerative medicine.

How can researchers investigate Pex3-mediated protein trafficking pathways?

Investigating Pex3-mediated protein trafficking requires specialized techniques to track the movement of proteins between cellular compartments. Effective methodologies include:

  • Live-cell imaging with fluorescently tagged Pex3 and interaction partners to visualize trafficking dynamics in real-time

  • Pulse-chase experiments combined with subcellular fractionation to track protein movement between ER and peroxisomes

  • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to Pex3 during different trafficking stages

  • Super-resolution microscopy (STORM, PALM) to visualize Pex3-containing subdomains at the ER-peroxisome interface

Studies have demonstrated that Pex3p initially targets to discrete ER-localized punctae, forming a dynamic ER subcompartment en route to mature peroxisomes . By employing these techniques with specific inhibitors of vesicular trafficking or cytoskeletal components, researchers can dissect the molecular mechanisms governing Pex3's role in peroxisome biogenesis and inheritance.

What are the implications of Pex3 mutations in human disease models?

Mutations in the PEX3 gene have profound implications for human health, particularly in peroxisome biogenesis disorders (PBDs). The causative role of PEX3 mutations in disease has been established through several lines of evidence:

  • A homozygous, inactivating missense mutation (G to A at position 413) resulting in a Gly138Glu substitution causes peroxisome deficiency in complementation group 17 ZPG208 cells

  • In patient PBDG-02 (from consanguineous Italian parents), a mutation in PEX3 prevented formation of peroxisomes, as assessed by staining for catalase and PMP70

  • Expression of normal human PEX3 restores peroxisome assembly in patient cells, while mutant PEX3 (e.g., flag-PEX3 delEx11) fails to complement the defect

To model these conditions effectively, researchers employ patient-derived fibroblasts, CRISPR-engineered cell lines with specific PEX3 mutations, and transgenic animal models. Such disease models provide platforms for testing therapeutic interventions, including gene therapy approaches and small molecule treatments targeting peroxisome biogenesis pathways.

How can researchers overcome solubility issues with recombinant Pex3?

The integral membrane nature of Pex3 presents significant solubility challenges. Researchers can implement several strategies to improve solubility while maintaining functionality:

  • Express truncated constructs containing soluble domains (e.g., the N-terminal 40 amino acids that contain targeting information)

  • Use detergent screening to identify optimal solubilization conditions (common effective detergents include CHAPS, DDM, and Triton X-100)

  • Employ fusion partners known to enhance solubility (MBP, SUMO, thioredoxin) with appropriate linkers and cleavage sites

  • Optimize buffer conditions, including pH, salt concentration, and addition of stabilizing agents like glycerol

  • Consider nanodiscs or liposome reconstitution for maintaining native-like membrane environments

When implementing these approaches, it's crucial to verify that solubilized Pex3 retains its functional capabilities, particularly Pex19p binding and complementation activity in deficient cell lines.

What controls should be included when analyzing Pex3 knockout phenotypes?

Proper experimental design for Pex3 knockout studies requires rigorous controls to ensure phenotypic specificity and rule out off-target effects:

  • Include wild-type controls from the same genetic background processed identically

  • Generate rescue controls by re-expressing Pex3 in knockout cells/animals to confirm phenotype reversibility

  • Use multiple independent knockout lines/animals to verify consistency of phenotypes

  • Include knockouts of functionally related proteins (e.g., Pex19) for comparative analysis

  • Employ domain mutants that selectively disrupt specific functions while preserving others

In myocardial regeneration studies, for example, researchers compared Pex3-KO and wild-type mice in parallel after apical resection, using multiple proliferation markers (Ki67, pH3, EdU, Aurora B) to comprehensively document the regenerative defect . They further demonstrated specificity by showing abnormal peroxisome morphology and increased ROS markers specifically in the Pex3-KO animals .

How can researchers effectively study Pex3-protein interactions in membrane environments?

Investigating protein interactions involving membrane-integrated proteins like Pex3 requires specialized approaches to maintain native conformations:

  • Membrane yeast two-hybrid systems specifically designed for membrane protein interactions

  • Bimolecular fluorescence complementation (BiFC) with membrane-compatible split fluorescent proteins

  • Crosslinking mass spectrometry using membrane-permeable crosslinkers

  • Surface plasmon resonance or microscale thermophoresis with detergent-solubilized or nanodisc-reconstituted proteins

  • Co-immunoprecipitation under conditions that preserve membrane integrity or with carefully optimized detergent solubilization

Studies of Pex3's interaction with class V myosin employed techniques that preserved the membrane environment, enabling detection of the direct interaction between Pex3/Pex3Bp and the myosin globular tail that mediates peroxisome inheritance . Similar approaches can be applied to study interactions with Pex19p and other peroxisomal proteins in their native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.