Recombinant Rat Peroxisomal membrane protein 11A (Pex11a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Pex11a; Pex11; Peroxisomal membrane protein 11A; 28 kDa peroxisomal integral membrane protein; PMP28; Peroxin-11A; Peroxisomal biogenesis factor 11A; Peroxisomal coatomer receptor; Peroxisomal membrane protein 26; Pmp26p; Protein PEX11 homolog alpha; PEX11-alpha; RnPEX11p
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pex11a
Target Protein Sequence
MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ LKLKAR
Uniprot No.

Target Background

Function
Pex11a may be involved in peroxisomal proliferation and the regulation of peroxisome division. It may mediate the binding of coatomer proteins to the peroxisomal membrane and promote membrane protrusion and elongation on the peroxisomal surface.
Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in kidney, liver, lung, brain, and testis and at low levels in heart, spleen and skeletal muscle.

Q&A

What is Rat Peroxisomal membrane protein 11A (Pex11a)?

Pex11a is a peroxin that plays a crucial role in regulating the number of peroxisomes in eukaryotic cells. It is one of several Pex11 family proteins found across species, with mammals having three paralogs (PEX11α, PEX11β, and PEX11γ). The protein is embedded in the peroxisomal membrane and participates in peroxisome proliferation and division processes . In rat models, Pex11a has been shown to be inducible by peroxisome proliferators and is regulated through specific transcriptional mechanisms involving peroxisome proliferator-activated receptors (PPARs) .

How is Pex11a gene expression regulated at the molecular level?

Pex11a gene expression is regulated through a peroxisome proliferator response element (PPRE) located approximately 8.4 kb downstream of the transcription initiation site. This PPRE has been shown to confer activation by both PPARα and PPARγ. Interestingly, this same PPRE also regulates the perilipin gene, which is located adjacent to the Pex11a gene, creating a bidirectional regulatory mechanism .

The PPRE sequence specifically binds to heterodimers formed between retinoid X receptor alpha (RXRα) and either PPARα or PPARγ2. The regulation is tissue-selective, with PPARα primarily binding to the PPRE in hepatocytes and PPARγ binding in adipocytes, as demonstrated by chromatin immunoprecipitation assays .

What are the established methods for studying Pex11a expression levels?

Several techniques have been validated for studying Pex11a expression:

  • RT-PCR Analysis: RNA can be normalized using housekeeping genes like 36B4 (a ribosomal protein). Researchers should set adequate PCR cycles to ensure band intensities can be compared in the exponential amplification phase .

  • Reporter Gene Assays: Luciferase reporter constructs containing the Pex11a promoter region and/or the downstream PPRE can be used to study transcriptional regulation. These constructs can be transfected into appropriate cell lines (e.g., HeLa cells or hepatoma cell lines) along with expression vectors for transcription factors like PPARα or PPARγ .

  • Chromatin Immunoprecipitation (ChIP): This technique can demonstrate in vivo binding of transcription factors to the Pex11a PPRE. In studies, antibodies against PPARα, PPARγ, pan-RXR, and CBP have been used to immunoprecipitate protein-DNA complexes, followed by PCR using primers specific for the Pex11a/perilipin-PPRE region .

How can recombinant Pex11a protein be produced for in vitro studies?

For producing recombinant Pex11a:

  • Expression Systems: The Pex11a cDNA can be cloned from rat tissue libraries using RT-PCR and inserted into appropriate expression vectors.

  • Fusion Proteins: Maltose-binding protein (MBP) or glutathione S-transferase (GST) fusion constructs can be created to facilitate purification and functional studies. These fusion proteins have been successfully used in electrophoretic mobility shift assays (EMSAs) to study PPRE binding .

  • Protein Purification: Standard chromatography techniques can be employed, with affinity purification being particularly useful for tagged recombinant proteins.

  • Quality Control: SDS-PAGE and Western blotting should be performed to verify protein purity and immunoreactivity.

How do PPARs regulate Pex11a expression in different tissues?

The regulation of Pex11a by PPARs shows remarkable tissue selectivity:

  • Hepatic Regulation: In liver cells, PPARα is the primary regulator of Pex11a expression. Treatment with PPARα agonists like Wy14,643 induces Pex11a expression in wild-type mice but not in PPARα-null mice .

  • Adipocyte Regulation: In adipose tissue, PPARγ preferentially binds to the Pex11a/perilipin PPRE. This selective binding was demonstrated through ChIP assays in differentiated adipocytes .

  • Subtype Selectivity: When combined with the natural promoters of Pex11a and perilipin genes, the PPRE confers subtype-selective activation, with different responses to PPARα and PPARγ2. For example, in some experimental contexts, PPARγ2 did not support transactivation from the PPRE, indicating that the function of this element was selective for PPAR subtypes .

The subtype-selective regulation is summarized in the following table:

Tissue TypeDominant PPAREffect on Pex11a
LiverPPARαStrong induction
AdiposePPARγModerate induction
Other tissuesVariousContext-dependent

What is known about the bidirectional regulation of Pex11a and perilipin?

A unique feature of Pex11a regulation is its bidirectional coordination with perilipin gene expression through a shared PPRE. This PPRE is located 8.4 kb downstream of the Pex11a transcription start site and 1.9 kb upstream of the perilipin gene .

The PPRE sequence (TCACCTTTCACCC) binds heterodimers of RXRα with either PPARα or PPARγ, as confirmed by electrophoretic mobility shift assays. Mutational analysis, where three bases of the PPRE were altered, abolished activation by PPARα, confirming this motif as the primary target of PPAR-mediated transactivation of the Pex11a gene .

Interestingly, the PPRE functions even when linearized plasmids are transfected into cells, confirming that it can work from the downstream side rather than requiring spatial proximity due to DNA looping in supercoiled plasmids .

What methods are most effective for studying Pex11a localization in cells?

High-content microscopy approaches have proven effective for studying Pex11a localization:

  • Fluorescent Protein Tagging: Genetic tagging of Pex11 with GFP has been successfully used in genome-wide screens to accurately determine subcellular localization patterns .

  • Confocal Microscopy: This technique allows for high-resolution imaging of Pex11-GFP localization. Automated confocal microscopy can be employed for high-throughput screening of localization patterns across multiple genetic backgrounds .

  • Computational Analysis: Quantitative analysis of microscopy images using software like CellProfiler can extract morphological features to objectively compare localization patterns. These features can be used to define an "outlyingness score" that identifies mutants with significantly altered Pex11 localization patterns .

  • Hierarchical Clustering: This approach can group mutants with similar Pex11 localization phenotypes, potentially identifying genes that function in related pathways .

What protein complexes and interactions involve Pex11a?

Studies suggest that Pex11a interacts with several cellular components:

  • ERMES Complex: The endoplasmic reticulum-mitochondria encounter structure (ERMES) complex appears to influence Pex11 localization. Deletion of ERMES components like Mdm10, Mdm12, and Mdm34 results in altered Pex11 localization patterns, suggesting a functional relationship .

  • Membrane Interactions: As a peroxisomal membrane protein, Pex11a likely interacts with other peroxisomal membrane components involved in peroxisome division and proliferation.

Pairwise distance calculations of Pex11-GFP localization patterns in various mutants have revealed:

Strain ComparisonSimilarity Level
mdm10Δ vs mdm12ΔExtremely similar
Wild-type vs mmm1ΔVery similar
Wild-type vs mdm10Δ/mdm12ΔVery different
mdm34ΔIntermediate phenotype

This data suggests specific relationships between cellular components that influence Pex11 localization and function .

How can genome-wide screening approaches be applied to study Pex11a function?

Genome-wide screening methods have proven valuable for understanding Pex11 function:

  • Systematic Gene Deletion Studies: By examining Pex11 localization in libraries of gene deletion mutants (both non-essential and temperature-sensitive essential genes), researchers can identify genes that influence Pex11 localization and function .

  • High-Content Microscopy: This approach enables rapid screening of thousands of strains to identify those with altered Pex11 localization patterns .

  • Computational Phenotype Analysis: Using vectors containing morphological features extracted from high-content microscopy images, researchers can apply outlier detection algorithms to identify mutant strains with significantly different Pex11 localization patterns .

In one study, analysis of 4292 non-essential gene deletion strains and 793 strains with temperature-sensitive alleles of 503 essential genes revealed 483 strains with abnormal Pex11-GFP localization patterns, of which 109 strains (104 genes) showed the most pronounced phenotypic changes .

What are the implications of Pex11a dysfunction in disease models?

While the search results don't provide specific details about Pex11a dysfunction in disease models, we can infer potential implications:

  • Peroxisome Proliferation Disorders: As Pex11a regulates peroxisome numbers, dysfunction could lead to abnormal peroxisome proliferation or deficiency.

  • Metabolic Diseases: Given the role of peroxisomes in lipid metabolism and the co-regulation of Pex11a with perilipin (a lipid droplet protein), Pex11a dysfunction might impact lipid homeostasis.

  • Neurological Disorders: The search results mention that mutation in the mammalian paralog PEX11β results in a neurological disorder, suggesting Pex11 family proteins are important for neuronal function .

What are common challenges in Pex11a expression studies and how can they be addressed?

Researchers working with Pex11a may encounter several challenges:

  • Promoter Activity Analysis: When studying the Pex11a promoter, be aware that some plasmid vectors contain cryptic PPRE-like sequences that can give slight background activation. Control experiments with empty vectors are essential to identify false positives .

  • Downstream Regulatory Elements: Since the Pex11a PPRE is located 8.4 kb downstream of the transcription start site, standard promoter analysis (which typically focuses on upstream regions) may miss important regulatory elements. Researchers should consider including downstream regions in regulatory studies .

  • Tissue-Specific Expression: Due to the tissue-selective binding of different PPAR subtypes to the Pex11a PPRE, results can vary depending on the cellular context. Selecting appropriate cell lines for studies is crucial .

How should researchers design experiments to study the tissue-specific regulation of Pex11a?

For effective studies of tissue-specific Pex11a regulation:

  • Cell Line Selection: Use appropriate cell models that reflect the tissue of interest (e.g., hepatocytes for liver-specific regulation, adipocytes for fat-specific regulation).

  • PPAR Subtype Expression: Verify the expression levels of different PPAR subtypes in your experimental system, as this will influence Pex11a regulation.

  • ChIP Assay Design: For in vivo binding studies, design ChIP assays with appropriate antibodies (anti-PPARα for liver studies, anti-PPARγ for adipose studies) .

  • Bidirectional Regulation: Consider the potential influence of perilipin regulation through the shared PPRE when designing experiments .

  • Control Regions: Include control regions distal to the PPRE in ChIP experiments to confirm specificity of transcription factor binding .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.