Recombinant Rat Peroxisome assembly protein 12 (Pex12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped on standard blue ice packs. Dry ice shipping is available upon request; however, additional fees will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
Pex12; Paf3; Peroxisome assembly protein 12; Peroxin-12; Peroxisome assembly factor 3; PAF-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pex12
Target Protein Sequence
MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFD EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFL VLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLR YILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
Uniprot No.

Target Background

Function

Essential for protein import into peroxisomes.

Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is Peroxisome Assembly Protein 12 (Pex12) and its functional significance?

Peroxisome assembly protein 12 (Pex12), also known as Peroxin-12 or Peroxisome assembly factor 3 (PAF-3), is a critical membrane-anchored protein involved in the biogenesis of peroxisomes. It functions as an essential component of the peroxisomal protein import machinery, specifically in the translocation of matrix proteins across the peroxisomal membrane. Rat Pex12 consists of 359 amino acids and contains specific domains that facilitate protein-protein interactions necessary for peroxisome formation and function .

Functionally, Pex12 operates as part of a complex with other peroxins (particularly Pex10 and Pex2) to form a RING-finger protein complex at the peroxisomal membrane. This complex functions as an E3 ubiquitin ligase that facilitates the recycling of peroxisomal import receptors, which is crucial for continued import of peroxisomal matrix proteins. The protein contains a zinc-binding RING finger domain in its C-terminal region, which is essential for its function in the protein import pathway .

Research significance lies in understanding peroxisome biogenesis disorders (PBDs), as mutations in PEX12 are the third most common cause of PBD-Zellweger syndrome spectrum (PBD-ZSS), accounting for approximately 4-11% of diagnosed cases . These disorders manifest as severe neurodevelopmental conditions with multi-organ dysfunction.

What expression systems are commonly used for recombinant rat Pex12 production?

The production of recombinant rat Peroxisome assembly protein 12 (Pex12) typically employs several expression systems, each with distinct advantages and limitations for protein quality and experimental applications.

The most common expression system for recombinant rat Pex12 is Escherichia coli (E. coli), as evidenced in the available product information. E. coli systems offer advantages including rapid growth, high protein yields, and cost-effectiveness . The recombinant Pex12 protein is commonly expressed with an N-terminal histidine (His) tag to facilitate purification through immobilized metal affinity chromatography (IMAC) .

Challenges in E. coli expression include:

  • Proper folding of the transmembrane segments

  • Formation of inclusion bodies requiring refolding protocols

  • Lack of post-translational modifications that may be present in native rat Pex12

For applications requiring post-translational modifications or improved folding, alternative expression systems might include:

  • Insect cell expression systems (Sf9, Sf21, or High Five cells): Better for membrane proteins with complex folding requirements

  • Mammalian expression systems (CHO, HEK293 cells): Optimal for studying functional aspects requiring mammalian post-translational modifications

  • Cell-free protein synthesis: Useful for producing proteins that may be toxic to host cells

A comparative analysis of expression systems demonstrates that the choice depends significantly on the research application. E. coli systems are preferred for structural studies and antibody production, while mammalian systems are more suitable for functional assays where proper folding and post-translational modifications are crucial .

What are the optimal storage and handling conditions for recombinant rat Pex12?

Proper storage and handling of recombinant rat Peroxisome assembly protein 12 (Pex12) is crucial for maintaining protein stability and experimental reproducibility. Based on manufacturer recommendations, the following protocols should be followed:

Storage conditions:

  • Long-term storage: -20°C to -80°C, with -80°C preferred for extended periods

  • Working aliquots: 4°C for up to one week to minimize freeze-thaw cycles

  • Storage buffer composition: Tris-based buffer with 50% glycerol, pH 8.0

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for cryoprotection

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

Important handling considerations:

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • When thawing frozen aliquots, keep on ice and use immediately

  • For experimental use, dilute in appropriate buffers immediately before the assay

  • Monitor protein stability by SDS-PAGE analysis before critical experiments

  • Consider adding protease inhibitors when working with the protein for extended periods

The manufacturer's data indicates that protein purity is typically greater than 90% as determined by SDS-PAGE, which should be verified upon reconstitution to ensure experimental quality .

What methodological approaches can validate recombinant rat Pex12 functionality in experimental systems?

Validating the functionality of recombinant rat Peroxisome assembly protein 12 (Pex12) is essential before using it in complex experimental systems. Several complementary methodological approaches can be employed to confirm both structural integrity and biological activity.

Structural validation methods:

  • SDS-PAGE and Western blotting: Confirms the correct molecular weight (approximately 40-45 kDa for the 359-amino acid protein plus tag) and immunoreactivity with Pex12-specific antibodies .

  • Circular dichroism (CD) spectroscopy: Evaluates secondary structure elements to confirm proper protein folding, particularly important for the RING finger domain.

  • Mass spectrometry: Provides precise mass determination and can identify post-translational modifications or proteolytic processing.

Functional validation methods:

  • In vitro binding assays: Assess interaction with known binding partners such as Pex5, Pex10, and Pex2 using techniques like:

    • Pull-down assays using the His-tag

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

  • Cell-based complementation assays: Transfect Pex12-deficient cell lines (derived from PBD-ZSS patients or Pex12-knockout models) with recombinant Pex12 and assess:

    • Restoration of peroxisome formation using immunofluorescence microscopy

    • Recovery of peroxisomal protein import using reporter proteins

    • Reestablishment of peroxisomal metabolic functions

  • E3 ubiquitin ligase activity assays: Evaluate the enzymatic function of the RING domain through:

    • In vitro ubiquitination assays with purified E1, E2 enzymes, ubiquitin, and potential substrates

    • Ubiquitination state analysis of Pex5 in reconstituted systems

  • Peroxisome import assays: Use semi-permeabilized cells or isolated peroxisomes to assess the ability of recombinant Pex12 to restore matrix protein import in deficient systems .

When validating results, it is important to include appropriate controls: wild-type protein, known non-functional mutants (e.g., RING domain mutations), and species-specific variations to account for potential functional differences between rat and human Pex12 .

How do mutations in PEX12 contribute to peroxisome biogenesis disorders, and what insights can be gained from rat models?

Mutations in the PEX12 gene are the third most common cause of peroxisome biogenesis disorders in the Zellweger syndrome spectrum (PBD-ZSS), accounting for approximately 4-11% of diagnosed cases . Understanding these mutations and their functional consequences provides critical insights into peroxisome biogenesis and potential therapeutic approaches.

Genotype-phenotype correlations in PEX12-related disorders:

  • Mutation types and consequences:

    • Missense mutations: Often result in partial protein function and milder phenotypes

    • Nonsense and frameshift mutations: Typically cause complete loss of function and severe disease manifestations

    • Splice site mutations: Variable effects depending on impact on protein structure

  • Clinical spectrum:

    • Severe Zellweger syndrome: Associated with complete loss of PEX12 function

    • Neonatal adrenoleukodystrophy and infantile Refsum disease: Partial PEX12 function

    • The severity correlates with residual peroxisomal function and metabolic pathway impairment

Rat Pex12 as a model system:

Studying recombinant rat Pex12 offers several advantages for understanding human disease mechanisms:

  • Structural homology: Rat Pex12 shares significant sequence and functional homology with human PEX12, particularly in critical domains like the RING finger motif.

  • Experimental advantages:

    • Generation of function-specific mutations to study domain importance

    • Analysis of interaction networks in a controlled system

    • Ability to introduce human disease-causing mutations into rat Pex12 for mechanistic studies

  • Translational insights:

    • Determination of which mutations affect protein stability versus specific functional interactions

    • Identification of critical residues for peroxisome assembly that could be targets for therapeutic development

    • Understanding species-specific differences that might impact the translation of findings to human applications

Research methodologies using rat Pex12 to study disease mechanisms:

  • Structure-function analysis: Introducing systematic mutations in rat Pex12 to map functional domains.

  • Interaction proteomics: Using tagged rat Pex12 variants to identify the complete interactome and how it changes with disease-causing mutations.

  • Cell-based assays: Complementation studies in PEX12-deficient cell lines to assess functional consequences of specific mutations.

  • In vitro reconstitution: Building minimal functional systems with purified components to understand the molecular basis of peroxisome protein import .

These approaches collectively provide a powerful platform for elucidating the molecular pathophysiology of PEX12-related disorders and developing targeted therapeutic strategies.

What experimental techniques can effectively study Pex12 protein-protein interactions in peroxisomal assembly?

Understanding the protein-protein interaction network of Peroxisome assembly protein 12 (Pex12) is crucial for elucidating its role in peroxisomal assembly. Several complementary experimental techniques can be employed to characterize these interactions in detail.

In vitro interaction analysis techniques:

  • Pull-down assays with recombinant proteins:

    • Using His-tagged rat Pex12 as bait to identify interaction partners from cell lysates

    • Reciprocal pull-downs with tagged potential binding partners

    • Quantitative analysis through Western blotting or mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics measurement (kon, koff, KD)

    • Analysis of how mutations affect binding parameters

    • Competitive binding assays to map interaction surfaces

  • Isothermal Titration Calorimetry (ITC):

    • Provides thermodynamic parameters of interactions (ΔH, ΔS, ΔG)

    • No labeling requirements, allowing native protein analysis

    • Can determine binding stoichiometry precisely

Cellular and in vivo interaction analysis:

  • Proximity Labeling Techniques:

    • BioID or TurboID fusion with Pex12 to identify proximal proteins in the peroxisomal membrane

    • APEX2 proximity labeling for temporal analysis of interaction networks

    • Spatial proteomics to map the Pex12 interaction landscape at the peroxisome membrane

  • Fluorescence-based interaction studies:

    • Förster Resonance Energy Transfer (FRET) to measure interactions between Pex12 and binding partners

    • Fluorescence Correlation Spectroscopy (FCS) for dynamic interaction analysis

    • Split-GFP complementation assays to visualize interactions in living cells

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking of interacting proteins followed by mass spectrometry analysis

    • Identification of specific residues involved in protein-protein interfaces

    • Mapping of interaction domains with amino acid-level resolution

Integrative structural biology approaches:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping interaction surfaces based on solvent protection

    • Conformational changes upon binding can be detected

  • Cryo-electron microscopy:

    • Structural analysis of Pex12 in complex with interaction partners

    • Visualization of conformational states during peroxisome assembly

A comprehensive experimental strategy would incorporate multiple complementary techniques to validate interactions and build a detailed model of how Pex12 functions within the peroxisomal protein import machinery. When using recombinant rat Pex12, it is essential to ensure proper folding and membrane insertion to maintain physiologically relevant interactions .

What are the critical considerations for using recombinant rat Pex12 in in vitro peroxisome assembly assays?

In vitro peroxisome assembly assays using recombinant rat Peroxisome assembly protein 12 (Pex12) require careful experimental design to recapitulate the complex membrane environment and protein interactions found in vivo. Several critical considerations must be addressed to ensure physiologically relevant results.

Protein preparation considerations:

  • Membrane protein reconstitution:

    • Pex12 is a transmembrane protein requiring a lipid environment for proper folding

    • Reconstitution options include:

      • Detergent micelles (using mild detergents like DDM or CHAPS)

      • Liposomes with peroxisome-like lipid composition

      • Nanodiscs for a more native-like membrane environment

    • Verification of proper insertion and orientation is essential using protease protection assays

  • Complex formation with other peroxins:

    • Pex12 functions within a complex including Pex10 and Pex2

    • Co-expression or sequential reconstitution of all three proteins may be necessary

    • Stoichiometry control is critical for physiological relevance

Assay design considerations:

  • Matrix protein import system components:

    • Purified components required: Pex5 (PTS1 receptor), Pex7/Pex14 (docking complex), ubiquitination machinery

    • Fluorescently labeled cargo proteins containing PTS1 or PTS2 signals

    • ATP regeneration system for energy-dependent steps

  • Functional readouts:

    • Ubiquitination of Pex5 as a measure of RING complex activity

    • Cargo translocation across the membrane barrier

    • Receptor recycling efficiency

    • ATP consumption during the import cycle

Experimental controls and validation:

  • Essential controls:

    • Catalytically inactive Pex12 mutants (RING domain mutations)

    • Systems lacking individual components to demonstrate requirement

    • Comparisons with different species' Pex12 to identify conserved mechanisms

  • Validation approaches:

    • Correlation with in vivo phenotypes of specific mutations

    • Complementation of Pex12-deficient peroxisome ghosts

    • Electron microscopy to visualize reconstituted complexes

Technical challenges and solutions:

ChallengePotential SolutionValidation Method
Maintaining Pex12 solubilityUse of appropriate detergents (e.g., DDM) or nanodiscsSize-exclusion chromatography profiles
Proper membrane orientationDirected reconstitution techniquesProtease protection assays
Complex assemblySequential addition protocolPull-down assays confirming interactions
Physiological activityATP-dependent ubiquitination assaysComparison with cell-based activity
Aggregation preventionAddition of stabilizing agents, optimizing buffer conditionsDynamic light scattering

When designing in vitro peroxisome assembly assays with recombinant rat Pex12, researchers should consider starting with simplified systems to establish basic functionality before progressing to more complex reconstitutions that more closely mimic the in vivo environment .

How can recombinant rat Pex12 be effectively used in developing research tools and diagnostics?

Recombinant rat Peroxisome assembly protein 12 (Pex12) offers significant potential as a resource for developing various research tools and diagnostic applications, particularly in the context of peroxisomal disorders. Several strategic applications can be considered:

Antibody development and validation:

  • Custom antibody production:

    • Using purified recombinant rat Pex12 as an immunogen for polyclonal or monoclonal antibody development

    • Epitope mapping using truncated versions of the protein

    • Cross-reactivity testing with human PEX12 for translational applications

  • Immunoassay development:

    • ELISA systems for quantitative detection of Pex12 in various samples

    • Immunohistochemistry protocols for tissue localization studies

    • Immunoprecipitation methods for studying Pex12 complexes in cell lysates

Functional assay development:

  • High-throughput screening platforms:

    • Development of assays to identify small molecules that modify Pex12 activity

    • Fluorescence-based interaction assays for drug discovery

    • RING domain ubiquitination activity assays for modulatory compound identification

  • Biosensor applications:

    • FRET-based biosensors using Pex12 and interacting partners

    • Activity-based probes to monitor Pex12 function in real-time

    • Split reporter systems for detecting protein-protein interactions in vivo

Diagnostic applications:

  • Reference standards for clinical testing:

    • Calibration standards for mass spectrometry-based diagnostics

    • Positive controls for genetic testing procedures

    • Training datasets for machine learning algorithms in diagnostic interpretation

  • Functional complementation assays:

    • Diagnostic testing of patient fibroblasts using recombinant Pex12

    • Assessing the functional significance of newly identified PEX12 variants

    • Correlation of biochemical phenotypes with genotypes

Methodological considerations:

When developing these applications, researchers should consider:

  • Protein stability requirements:

    • Buffer optimization for specific applications

    • Addition of stabilizing agents for long-term storage

    • Appropriate aliquoting to maintain consistency across experiments

  • Validation parameters:

    • Specificity testing against related proteins

    • Sensitivity determination in complex biological matrices

    • Reproducibility assessment across different laboratories

  • Species cross-reactivity:

    • Careful validation when translating rat-based tools to human applications

    • Identification of conserved epitopes for cross-species applications

    • Comparison studies with human PEX12 to determine functional equivalence

By leveraging high-quality recombinant rat Pex12, researchers can develop a diverse array of tools that advance both basic science understanding of peroxisome biology and clinical applications for peroxisomal disorders.

What are common troubleshooting strategies for experiments involving recombinant rat Pex12?

Working with recombinant Peroxisome assembly protein 12 (Pex12) presents several technical challenges due to its nature as a membrane protein with multiple functional domains. The following troubleshooting guide addresses common issues researchers may encounter and provides methodological solutions:

Problem 1: Poor protein solubility and aggregation

Potential causes:

  • Improper reconstitution from lyophilized state

  • Incompatible buffer conditions

  • Protein misfolding during expression

Solutions:

  • Optimize reconstitution protocol:

    • Reconstitute slowly at lower protein concentrations (0.1-0.5 mg/mL)

    • Use mild detergents (0.1% DDM or 0.5% CHAPS) to improve solubility

    • Consider adding glycerol (up to 10%) to prevent aggregation

  • Centrifuge at 10,000×g for 10 minutes after reconstitution to remove any aggregates

  • Verify solubility by size-exclusion chromatography or dynamic light scattering

Problem 2: Loss of protein activity

Potential causes:

  • Denaturation during freeze-thaw cycles

  • Improper storage conditions

  • Proteolytic degradation

Solutions:

  • Minimize freeze-thaw cycles by preparing single-use aliquots

  • Add protease inhibitor cocktail to working solutions

  • Perform activity assays immediately after thawing

  • Monitor protein integrity by SDS-PAGE before critical experiments

Problem 3: Inconsistent binding in interaction studies

Potential causes:

  • Improper protein folding

  • Interference from tags

  • Non-specific binding

Solutions:

  • Verify protein folding using circular dichroism or limited proteolysis

  • Test both N-terminal and C-terminal tagged versions

  • Include appropriate controls:

    • RING domain mutants

    • Binding-deficient mutants

    • Competition with untagged protein

Problem 4: Poor results in cell-based complementation assays

Potential causes:

  • Insufficient protein delivery into cells

  • Incompatibility with cellular machinery

  • Improper subcellular targeting

Solutions:

  • Optimize transfection or protein delivery methods:

    • Test different transfection reagents

    • Consider protein transduction domains

    • Use permeabilized cell systems for direct delivery

  • Verify subcellular localization using immunofluorescence microscopy

  • Use positive controls with known activity to validate the assay system

Troubleshooting decision tree:

ObservationInitial TestIf PositiveIf Negative
Visible precipitationCentrifuge and test supernatant activityUse supernatant at lower concentrationTry different reconstitution buffer
No activity in binding assaysSDS-PAGE for protein integrityCheck buffer compatibilityPrepare fresh protein batch
Degradation bands on SDS-PAGEAdd protease inhibitorsMonitor stability over timeExpress new protein batch with different tags
No complementation in cellsImmunofluorescence for protein localizationOptimize delivery methodCheck for species incompatibility

When troubleshooting experiments with recombinant rat Pex12, it is advisable to include appropriate positive and negative controls at each step, and systematically vary one parameter at a time to identify the specific issue affecting your experimental system .

How does rat Pex12 compare to human PEX12 in structure and function?

Comparative analysis of rat Peroxisome assembly protein 12 (Pex12) and human PEX12 reveals important similarities and differences that have implications for translational research. Understanding these comparative aspects is crucial when using rat Pex12 as a model for human peroxisomal disorders.

Sequence homology and conservation:

Rat and human PEX12 proteins share approximately 85% sequence identity at the amino acid level, with highest conservation in functional domains. The 359-amino acid rat Pex12 and 359-amino acid human PEX12 demonstrate:

  • Highly conserved regions:

    • C-terminal RING finger domain (>90% identity) - critical for E3 ligase activity

    • Transmembrane domains - essential for proper membrane insertion

    • Binding interfaces for other peroxins (Pex5, Pex10, Pex2)

  • Variable regions:

    • N-terminal domains show lower conservation (~70% identity)

    • Linker regions between functional domains

    • Some species-specific post-translational modification sites

Functional comparison:

Despite high sequence conservation, there are noteworthy functional differences:

  • E3 ligase activity: Both proteins function as E3 ubiquitin ligases, but studies suggest potential differences in substrate specificity and catalytic efficiency.

  • Interaction network: While core interactions with the RING complex (Pex10, Pex2) are conserved, some species-specific interaction partners have been identified.

  • Regulatory mechanisms: Differences in phosphorylation sites and other post-translational modifications may result in distinct regulatory responses.

Structural considerations:

Structural analysis through predictive modeling suggests:

  • Conserved structural elements:

    • RING domain adopts the characteristic cross-brace structure in both species

    • Transmembrane topology shows similar organization

    • Critical zinc-coordinating residues are identical

  • Species-specific structural features:

    • Subtle differences in surface-exposed residues may affect protein-protein interactions

    • Potential differences in protein dynamics and conformational flexibility

Implications for translational research:

When using rat Pex12 as a model for human studies:

  • Advantages:

    • High conservation in functional domains enables study of core mechanisms

    • Similar size and domain organization facilitate structural insights

    • Conservation of disease-causing mutation sites allows modeling of human pathology

  • Limitations:

    • Species-specific interaction partners may complicate interpretation of results

    • Potential differences in regulatory mechanisms

    • Some human disease mutations may have species-specific effects

This comparative analysis highlights the value of rat Pex12 as a model for studying fundamental aspects of peroxisome biogenesis while also emphasizing the importance of validating key findings in human systems before clinical translation.

What emerging technologies are advancing our understanding of Pex12 function in peroxisome biogenesis?

The study of Peroxisome assembly protein 12 (Pex12) and its role in peroxisome biogenesis has been revolutionized by several emerging technologies that enable unprecedented insights into protein function, interaction networks, and disease mechanisms.

Advanced structural biology approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane protein complexes

    • Visualization of Pex12 within the context of the RING complex (Pex12/Pex10/Pex2)

    • Multiple conformational states can be captured, revealing dynamic aspects of function

  • Integrative structural biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

Genome editing and high-throughput screening:

  • CRISPR/Cas9 technology:

    • Generation of precise Pex12 mutations corresponding to human disease variants

    • Creation of cellular models with fluorescently tagged endogenous Pex12

    • Genome-wide screens for synthetic lethal interactions with Pex12 mutations

  • High-content screening platforms:

    • Automated imaging systems to monitor peroxisome dynamics in real-time

    • Small molecule screens for compounds that modulate Pex12 function

    • Functional complementation assays in patient-derived cells

Advanced imaging technologies:

  • Super-resolution microscopy:

    • Nanoscale visualization of Pex12 organization at the peroxisomal membrane

    • Single-molecule tracking to monitor dynamics and interaction kinetics

    • Correlative light and electron microscopy (CLEM) for structural-functional studies

  • Live-cell imaging applications:

    • FRET-based biosensors to monitor Pex12 activity in real-time

    • Optogenetic control of Pex12 function to dissect temporal requirements

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

Systems biology and computational approaches:

  • Interactome mapping:

    • Proximity labeling proteomics (BioID, APEX) to identify the complete Pex12 interaction network

    • Temporal analysis of interaction dynamics during peroxisome biogenesis

    • Cross-species interactome comparison between rat and human systems

  • Computational modeling:

    • Molecular dynamics simulations of Pex12 in membrane environments

    • Machine learning approaches to predict functional consequences of mutations

    • Systems-level modeling of peroxisome biogenesis pathways

Translational research technologies:

  • Patient-derived models:

    • iPSC-derived cells from PBD-ZSS patients with PEX12 mutations

    • Organoid systems to model tissue-specific effects of Pex12 dysfunction

    • Humanized animal models expressing human PEX12 variants

  • Therapeutic development platforms:

    • Gene therapy approaches for PEX12 replacement

    • Protein engineering to develop enhanced Pex12 variants

    • Drug screening platforms targeting specific functional aspects of Pex12

These emerging technologies are synergistically advancing our understanding of Pex12 function and creating new opportunities for therapeutic development for peroxisomal disorders .

What are the future directions for research on recombinant rat Pex12?

Research on recombinant rat Peroxisome assembly protein 12 (Pex12) continues to evolve, with several promising future directions that will enhance our understanding of peroxisome biogenesis and potentially lead to therapeutic interventions for peroxisomal disorders. Key research trajectories include:

Structural biology advancements:
The determination of high-resolution structures of Pex12, particularly in complex with other peroxins, remains a significant challenge and opportunity. Future work will likely focus on:

  • Cryo-EM structures of the complete RING complex (Pex12/Pex10/Pex2)

  • Conformational dynamics during the peroxisomal import cycle

  • Structural basis for disease-causing mutations and their effects on protein function

Functional reconstitution systems:
Development of increasingly sophisticated in vitro systems that recapitulate the complex process of peroxisomal protein import will be a key focus:

  • Complete reconstitution of the peroxisomal import machinery with purified components

  • Real-time single-molecule analysis of matrix protein translocation

  • Quantitative biophysical measurements of the energetics and kinetics of import

Translational research applications:
Bridging basic science and clinical applications represents a critical area for future investigation:

  • Development of high-throughput screening methods to identify small molecule modulators of Pex12 function

  • Gene therapy approaches targeting PEX12 mutations

  • Personalized medicine strategies based on specific PEX12 variants in patients

Systems biology integration:
Understanding Pex12 within the broader context of cellular metabolism and signaling networks:

  • Temporal analysis of the peroxisome interactome during organelle biogenesis

  • Cross-talk between peroxisomes and other organelles

  • Tissue-specific regulation and function of Pex12

Technological innovations:
Emerging methodologies will continue to drive discoveries in Pex12 biology:

  • Novel protein engineering approaches to enhance Pex12 stability and activity

  • Advanced imaging techniques for single-molecule tracking in live cells

  • Computational approaches to predict functional consequences of mutations and design targeted interventions

The convergence of these research directions will provide comprehensive insights into the fundamental mechanisms of peroxisome biogenesis and the pathophysiology of peroxisomal disorders, ultimately leading to improved diagnostic and therapeutic strategies for patients with PEX12 mutations .

How can improved understanding of Pex12 contribute to therapeutic development for peroxisomal disorders?

The expanding knowledge of Peroxisome assembly protein 12 (Pex12) biology offers significant opportunities for therapeutic development targeting peroxisomal biogenesis disorders (PBDs). Translating basic research findings into clinical applications remains challenging but holds promise for patients with currently incurable peroxisomal disorders.

Mutation-specific therapeutic approaches:

  • Pharmacological chaperones:

    • Small molecules designed to stabilize partially misfolded Pex12 proteins

    • Most applicable to missense mutations that affect protein folding but not catalytic activity

    • High-throughput screening of compound libraries using recombinant Pex12 variants can identify candidate molecules

  • Premature termination codon (PTC) read-through:

    • Compounds that promote ribosomal read-through of nonsense mutations

    • Potentially applicable to approximately 30% of PEX12 mutations that introduce premature stop codons

    • Combined with stabilizing agents to enhance the half-life of resulting proteins

  • RNA-based therapeutics:

    • Antisense oligonucleotides (ASOs) to modulate splicing defects

    • RNA editing approaches to correct point mutations

    • Small interfering RNAs (siRNAs) to selectively downregulate dominant-negative mutants

Gene and protein replacement strategies:

  • Gene therapy approaches:

    • Adeno-associated virus (AAV) vectors for PEX12 gene delivery

    • Tissue-specific targeting strategies for organs most affected in PBDs

    • Genome editing to correct pathogenic mutations in patient cells

  • Protein replacement considerations:

    • Delivery systems for recombinant Pex12 protein (cell-penetrating peptides, nanoparticles)

    • Engineered variants with enhanced stability and membrane insertion capabilities

    • Temporally controlled delivery systems for developmental rescue

Pathway modulation strategies:

  • Enhancing residual peroxisome function:

    • Compounds that upregulate other peroxins to compensate for Pex12 deficiency

    • Metabolic bypasses for critical peroxisomal pathways

    • Activation of redundant cellular mechanisms for peroxisome formation

  • Reducing toxic metabolite accumulation:

    • Dietary interventions to limit precursors of accumulating compounds

    • Enhancing alternative metabolic pathways

    • Scavenging approaches for reactive species generated by peroxisomal dysfunction

Translational research considerations:

The path from recombinant protein studies to effective therapies requires:

  • Robust disease models:

    • Patient-derived iPSCs differentiated into relevant cell types

    • Humanized animal models expressing human PEX12 variants

    • Organoid systems to model tissue-specific effects

  • Biomarker development:

    • Indicators of peroxisome function to monitor therapeutic efficacy

    • Personalized approaches based on specific mutations and their functional consequences

    • Non-invasive monitoring techniques for long-term follow-up

  • Combinatorial approaches:

    • Integration of multiple therapeutic strategies for synergistic effects

    • Personalized treatment regimens based on specific genetic and biochemical profiles

    • Addressing multiple peroxisomal functions simultaneously

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.