Recombinant Rat Phosphate carrier protein, mitochondrial (Slc25a3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Rat Slc25a3

Gene Structure:

  • The Slc25a3 gene encodes a 362-amino acid protein with six transmembrane helices, forming a channel for phosphate transport .

  • Alternative splicing generates isoforms with distinct substrate affinities and tissue-specific expression . In humans, isoforms A (cardiac/skeletal muscle) and B (ubiquitous) differ by 13 residues; rat isoforms likely follow similar patterns .

Protein Features:

PropertyDetails
Molecular Weight~40 kDa (calculated)
DomainsThree tandem repeats for substrate binding; cytosolic N/C-termini
Transport MechanismProton-coupled symport or hydroxyl ion exchange
SubstratesPhosphate (primary), copper (secondary)

Recombinant Production and Purification

Expression System:

  • Produced in Escherichia coli with an N-terminal His tag for affinity purification .

Phosphate Transport:

  • Essential for ATP synthesis: Delivers Pi to mitochondrial matrix for phosphorylation of ADP .

  • Knockout models show impaired oxidative phosphorylation, lactic acidosis, and cardiomyopathy .

Copper Transport:

  • Dual substrate specificity: Facilitates copper uptake for cytochrome c oxidase (COX) assembly .

  • Structural studies identify residue L175 as critical for phosphate selectivity; mutations (e.g., L175A) abolish Pi transport but retain Cu transport .

Disease Associations

Mutations in SLC25A3 are linked to:

  • Mitochondrial Phosphate Carrier Deficiency (MPCD): Fatal infantile disorder with lactic acidosis, cardiomyopathy, and muscle hypotonia .

  • Cardiac Hypertrophy: Reduced Pi transport disrupts ATP synthesis, leading to mitochondrial cardiomyopathy .

Research Applications

  • Metabolic Studies: Investigate Pi/Cu transport kinetics using proteoliposomes .

  • Therapeutic Screening: Test compounds targeting mitochondrial energy deficits .

  • Disease Modeling: Study MPCD pathophysiology in cell or animal models .

Key Research Findings

  • Copper-Phosphate Crosstalk: SLC25A3’s dual role suggests metabolic interplay between Pi availability and Cu-dependent enzyme activity .

  • Isoform-Specific Deficits: Human isoform A mutations cause muscle-specific ATP synthesis defects, highlighting tissue-specific vulnerabilities .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a3; Phc; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; Solute carrier family 25 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-356
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a3
Target Protein Sequence
AVEGYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSIT LKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLAASA SAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPVWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTE
Uniprot No.

Target Background

Function
This protein facilitates the transport of phosphate groups from the cytosol into the mitochondrial matrix. Phosphate is cotransported with H(+). It may play a role in regulating the mitochondrial permeability transition pore (mPTP).
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of SLC25A3?

SLC25A3 (Phosphate carrier protein, mitochondrial) is a multi-pass transmembrane protein localized to the inner mitochondrial membrane that primarily functions to transport phosphate ions into the mitochondrial matrix for oxidative phosphorylation. The protein contains six transmembrane segments with a large extramembranous loop, with both N-terminal and C-terminal regions protruding toward the cytosol . It contains three related segments arranged in tandem that are characteristic of the mitochondrial carrier family proteins .

The SLC25A3 gene is located on chromosome 12q23.1, spans 8,376 base pairs, contains 9 exons, and produces a 40.1 kDa protein composed of 362 amino acids . Recent research has also revealed that SLC25A3 functions as a copper transporter, capable of transporting copper both in vitro and in vivo .

What are the known isoforms of SLC25A3 and how do they differ?

SLC25A3 exists in two significant isoforms resulting from alternative splicing of exon 3:

IsoformAlternative NameTissue ExpressionKey Characteristics
SLC25A3-APHC-AHeart and skeletal muscleContains 42 amino acids; differs by 13 amino acids between residues 54-80
SLC25A3-BPHC-BAll other tissuesContains 41 amino acids; ~3-fold higher phosphate transport rate than SLC25A3-A

The two isoforms exhibit different substrate affinities and transport rates in vitro . The selective expression pattern suggests tissue-specific roles, with the A isoform being critical for cardiac function. Mutations specific to the SLC25A3-A isoform have been associated with multisystem disorders characterized by muscle hypotonia, lactic acidosis, and hypertrophic cardiomyopathy .

How can I verify the purity and activity of recombinant rat SLC25A3 protein?

To verify purity and activity of recombinant rat SLC25A3:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie staining to visualize a single band at approximately 40 kDa

    • Western blotting using anti-SLC25A3 antibodies for specific detection

    • Mass spectrometry analysis to confirm the precise molecular weight and protein sequence

  • Activity Verification:

    • Reconstitution into proteoliposomes for phosphate transport assays

    • Measure radioisotope-labeled phosphate (³²P) uptake into liposomes containing the reconstituted protein

    • Assess inhibition by known transport inhibitors (such as N-ethylmaleimide)

    • Use arsenate as a toxic mimetic of phosphate to verify transporter function in heterologous expression systems

  • Copper Transport Activity:

    • Measure copper uptake into liposomes containing reconstituted SLC25A3 using radioactive copper (⁶⁴Cu) or fluorescent copper indicators

    • Verify specificity using competing cations and known transport inhibitors

What expression systems are most effective for producing functional recombinant rat SLC25A3?

Multiple expression systems have been successfully used for producing functional SLC25A3:

Expression SystemAdvantagesLimitationsValidation Methods
E. coliHigh yield, cost-effective, rapid productionLacks post-translational modifications, may form inclusion bodiesTransport activity in reconstituted liposomes, complementation of bacterial phosphate transport mutants
Yeast (S. cerevisiae)Eukaryotic processing, functional in pic2Δ backgroundLower yield than bacterial systemsMitochondrial copper uptake rescue, COX defect complementation under copper limitation
Lactococcus lactisEffective for membrane protein expressionMay not include all post-translational modificationsGrowth inhibition assays using silver (for copper transport) or arsenate (for phosphate transport)
Mammalian cells (HEK293)Native-like post-translational modificationsLower yield, higher costCo-immunoprecipitation studies, interaction with known binding partners

For rat SLC25A3 specifically, expression in either yeast or bacterial systems often provides sufficient quantities for most research applications, with functional validation through transport assays in reconstituted systems .

How does SLC25A3 interact with the mitochondrial permeability transition pore (MPTP) complex?

SLC25A3 has been implicated in the regulation of the mitochondrial permeability transition pore (MPTP), which plays a key role in cell death. Current evidence suggests that:

These interactions suggest SLC25A3 functions within a larger protein complex that regulates mitochondrial permeability and calcium handling. The identification of SLC25A3 as an MPTP regulator offers potential therapeutic targets for reducing necrotic cell death in conditions like ischemia-reperfusion injury .

What is the relationship between SLC25A3 and NLRP3 inflammasome regulation?

Recent research has identified a novel interaction between SLC25A3 and the NLRP3 inflammasome, suggesting a role for SLC25A3 in inflammation regulation:

  • SLC25A3 physically interacts with NLRP3 as demonstrated by:

    • Co-immunoprecipitation experiments in HEK293T cells

    • Glutathione-S-transferase pull-down assays showing direct interaction between NLRP3 (particularly its leucine-rich repeat domain) and SLC25A3 in vitro

  • The interaction between NLRP3 and SLC25A3 appears stronger than other identified protein interactions (e.g., with EEF1A1)

  • Functional significance:

    • SLC25A3 may negatively regulate NLRP3 inflammasome activation

    • This suggests a potential link between mitochondrial phosphate transport and inflammation

    • Could represent a novel therapeutic target for inflammatory conditions

Further research is needed to elucidate the precise mechanism by which SLC25A3 regulates inflammasome activity and whether this regulation is dependent on its transport function or involves separate protein-protein interaction domains.

How can genetic models of SLC25A3 deficiency be used to study mitochondrial metabolism?

Genetic models of SLC25A3 deficiency provide valuable insights into mitochondrial metabolism and associated pathologies:

  • Cardiac-specific inducible knockout models:

    • Generated using Cre-loxP technology with tamoxifen-inducible Cre expression under α-myosin heavy chain promoter

    • Allow temporal control of gene deletion to study acute vs. chronic effects

    • Demonstrate that long-term deletion results in profound cardiac hypertrophy with ventricular dilation and depressed function

  • Key metabolic phenotypes:

    • Impaired oxidative phosphorylation due to limited phosphate availability

    • Metabolic remodeling to compensate for decreased ATP production

    • Altered mitochondrial calcium handling with increased calcium retention capacity

    • Modified susceptibility to ischemia-reperfusion injury

  • Research applications:

    • Serve as models for human mitochondrial phosphate carrier deficiency (MPCD)

    • Allow investigation of the temporal progression of metabolic cardiomyopathy

    • Enable testing of metabolic interventions to rescue phosphate transport defects

    • Provide insights into the relationship between mitochondrial metabolism and cell death pathways

  • Experimental considerations:

    • Complete deletion is embryonically lethal, necessitating conditional approaches

    • Mosaic or partial knockdown models may better represent human disease states

    • Compensatory upregulation of other phosphate transporters may occur

These models demonstrate that SLC25A3 is essential for normal cardiac function, and its loss leads to a cardiomyopathy similar to that observed in humans with mutations in the gene .

What are the mechanisms underlying SLC25A3-associated cardiomyopathy?

SLC25A3-associated cardiomyopathy involves several interrelated mechanisms:

  • Bioenergetic crisis:

    • Reduced mitochondrial phosphate uptake limits ATP synthesis

    • Energy deficit impairs cardiac contractile function

    • Compensatory metabolic remodeling (increased glycolysis, altered substrate utilization) is insufficient to maintain energy homeostasis

  • Mitochondrial dysfunction cascade:

    • Primary phosphate transport defect → reduced ATP synthesis

    • Altered mitochondrial membrane potential

    • Disrupted calcium handling

    • Modified reactive oxygen species production

    • Potential activation of mitochondrial quality control mechanisms (mitophagy, fission/fusion)

  • Cardiac remodeling:

    • Energy deficit activates stress-response pathways

    • Hypertrophic growth as a compensatory mechanism

    • Progressive ventricular dilation and wall thinning

    • Eventual transition to decompensated heart failure

  • Modified cell death susceptibility:

    • Paradoxical protection against acute ischemia-reperfusion injury

    • Desensitized MPTP opening in response to calcium

    • Increased calcium retention capacity

    • Altered balance between apoptotic and necrotic cell death pathways

Therapeutic approaches might target these various mechanisms, potentially including metabolic modulators, antioxidants, mitochondrial-targeted compounds, or agents that enhance alternative phosphate transport pathways.

What are the most effective methods for studying SLC25A3 transport kinetics?

Studying SLC25A3 transport kinetics requires specialized approaches:

  • Reconstituted liposome systems:

    • Purified SLC25A3 is incorporated into artificial liposomes

    • Transport initiated by creating ion gradients or membrane potentials

    • Radioisotope-labeled substrates (³²P, ⁶⁴Cu) used to measure uptake rates

    • Kinetic parameters (Km, Vmax) determined through concentration-dependent assays

    • Inhibitors and competing substrates used to establish specificity

  • Heterologous expression systems:

    • Yeast (pic2Δ background) - measures rescue of mitochondrial copper uptake

    • Lactococcus lactis - measures toxicity of transport substrates (silver, arsenate)

    • Allows comparison between different SLC25A3 isoforms or mutant proteins

  • Isolated mitochondria assays:

    • Mitochondria isolated from tissues expressing recombinant SLC25A3

    • Measures substrate uptake into intact organelles

    • Membrane potential manipulations using uncouplers and inhibitors

    • Real-time monitoring using fluorescent indicators or oxygen consumption

  • Patch-clamp electrophysiology:

    • Direct measurement of ion currents through single channels

    • Allows precise characterization of transport mechanisms

    • Can determine if transport is electrogenic or electroneutral

When designing transport kinetics experiments, researchers should consider factors such as substrate concentration ranges, pH dependence, effects of membrane potential, and potential coupling to other ion gradients.

How can I investigate the dual function of SLC25A3 in phosphate and copper transport?

Investigating the dual transport functions of SLC25A3 requires specialized approaches:

  • Distinguishing between transport pathways:

    • Selective inhibitors: Use specific inhibitors of phosphate transport to isolate copper transport activity

    • Substrate competition studies: Examine how phosphate and copper transport activities impact each other

    • Mutagenesis: Generate mutants that selectively impact one transport function but not the other

  • Copper transport specific assays:

    • Measure mitochondrial copper uptake in isolated mitochondria

    • Assess rescue of COX defects in copper-limited conditions

    • Monitor growth of SLC25A3-expressing yeast (pic2Δ background) in copper-limited media

    • Silver toxicity assays in L. lactis (silver serves as a toxic copper mimetic)

  • Determining the form of transported copper:

    • Fluorescence anisotropy to study interaction with copper chelates

    • Spectroscopic studies to identify copper binding sites

    • Investigate the potential transport of copper-anion complexes rather than free copper ions

  • Physiological relevance:

    • Examine copper delivery to cytochrome c oxidase (COX)

    • Assess rescue of COX deficiency in copper-limited conditions

    • Investigate whether phosphate levels influence copper transport and vice versa

This dual functionality raises interesting questions about the evolution of transport proteins and suggests potential regulatory mechanisms linking energy metabolism and copper homeostasis in mitochondria.

What are emerging areas of SLC25A3 research beyond its established roles?

Several emerging research areas are expanding our understanding of SLC25A3 beyond its classical functions:

  • Inflammation regulation:

    • Newly discovered interaction with NLRP3 inflammasome

    • Potential role in linking mitochondrial metabolism to inflammatory responses

    • Implications for inflammatory diseases and potential therapeutic targeting

  • Cell death pathway modulation:

    • Regulation of MPTP activity and calcium-induced cell death

    • Potential protective role in ischemia-reperfusion injury

    • Therapeutic potential for cytoprotective strategies in stroke, myocardial infarction, and other conditions

  • Metabolic sensing and signaling:

    • Potential role as a metabolic sensor linking phosphate availability to mitochondrial function

    • Involvement in retrograde signaling from mitochondria to nucleus

    • Interactions with other mitochondrial proteins in larger metabolic complexes

  • Redox regulation:

    • Connection between copper transport and oxidative metabolism

    • Potential impact on mitochondrial reactive oxygen species production

    • Role in maintaining redox balance in high-energy tissues

  • Structural biology approaches:

    • Cryo-EM studies to determine the three-dimensional structure of SLC25A3

    • Elucidation of the transport mechanism at atomic resolution

    • Rational design of modulators to selectively affect different transport functions

These emerging areas suggest that SLC25A3 functions within a complex network of mitochondrial proteins that integrate metabolism, ion homeostasis, and cellular signaling pathways.

What techniques are being developed to modulate SLC25A3 activity for therapeutic purposes?

Emerging approaches to modulate SLC25A3 activity for potential therapeutic applications include:

  • Pharmacological modulators:

    • Development of specific inhibitors or activators based on substrate analogs

    • Small molecule screening for compounds that modulate SLC25A3-mediated transport

    • Isoform-specific modulators that target either SLC25A3-A or SLC25A3-B

  • Gene therapy approaches:

    • AAV-mediated delivery of functional SLC25A3 for genetic deficiencies

    • Targeted gene editing using CRISPR/Cas9 to correct pathogenic mutations

    • Regulated expression systems to fine-tune SLC25A3 levels

  • Post-translational modification targeting:

    • Identification of regulatory modifications (phosphorylation, acetylation, etc.)

    • Development of compounds that affect these modifications

    • Manipulation of SLC25A3 stability or localization

  • Metabolic bypass strategies:

    • Alternative phosphate delivery methods that bypass SLC25A3

    • Metabolic rewiring to reduce dependence on oxidative phosphorylation

    • Supplementation with cell-permeable phosphate analogs

  • Protein-protein interaction modulators:

    • Compounds that affect SLC25A3 interactions with NLRP3 or MPTP components

    • Peptide-based inhibitors of specific protein interfaces

    • Allosteric modulators that affect interaction domains

These approaches could have applications in treating conditions ranging from inherited mitochondrial phosphate carrier deficiency to ischemia-reperfusion injury, inflammatory diseases, and metabolic disorders affecting high-energy tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.