Recombinant Rat Phosphatidylcholine:ceramide cholinephosphotransferase 2 (Sgms2)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Phosphatidylcholine:ceramide cholinephosphotransferase 2 (Sgms2), also known as Sphingomyelin Synthase 2, is an enzyme that catalyzes the reversible transfer of phosphocholine from phosphatidylcholine to ceramide, resulting in the formation of sphingomyelin and diacylglycerol . This enzyme is classified under EC 2.7.8.27 and represents one of the two functional sphingomyelin synthases identified in mammals, the other being Sphingomyelin Synthase 1 (Sgms1) .

Physical and Biochemical Properties

As a recombinant protein, rat Sgms2 is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . The recommended storage conditions are -20°C for regular use and -20°C to -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week . The protein exhibits optimal activity at physiological pH and temperature.

Catalytic Mechanism

Sgms2 functions as a bidirectional transferase that catalyzes two main reactions:

  1. Forward reaction: Transfers the phosphocholine head group from phosphatidylcholine (PC) to ceramide (CER), producing sphingomyelin (SM) and diacylglycerol (DAG) as a by-product .

  2. Reverse reaction: Transfers phosphocholine from sphingomyelin to diacylglycerol, producing phosphatidylcholine and ceramide .

The direction of the reaction is largely dependent on the relative concentrations of ceramide and diacylglycerol in the membrane . Importantly, Sgms2 does not utilize free phosphorylcholine or CDP-choline as donors, requiring phospholipids with two fatty chains on the choline-phosphate donor molecule for efficient substrate recognition .

Substrate Specificity

Sgms2 exhibits specific substrate preferences. Studies have shown that it efficiently recognizes phosphatidylcholine as a substrate but can also use sphingomyelin itself as a donor of the phosphocholine group . Interestingly, Sgms2 can also transfer the phosphoethanolamine head group from phosphatidylethanolamine (PE) to ceramide, forming ceramide phosphoethanolamine (CPE) .

Research has demonstrated that non-choline phospholipids such as phosphatidylethanolamine (PE), phosphatidylinositol (PI), phosphatidylserine (PS), phosphatidic acid (PA), and phosphatidylglycerol (PG) are not utilized as substrates for sphingomyelin formation .

Cellular Localization and Function

While Sgms1 is primarily localized in the Golgi apparatus, Sgms2 primarily contributes to sphingomyelin synthesis and homeostasis at the plasma membrane . This differential localization suggests distinct physiological roles for the two sphingomyelin synthases.

Sgms2 regulates receptor-mediated signal transduction through multiple mechanisms:

  • Modulating levels of mitogenic diacylglycerol

  • Influencing proapoptotic ceramide

  • Maintaining sphingomyelin levels in membrane rafts that serve as platforms for signal transduction and protein sorting

Additionally, Sgms2 plays a role in secretory transport via regulation of the diacylglycerol pool at the Golgi apparatus and its downstream effects on protein kinase D1 (PRKD1) .

Expression Systems

Recombinant rat Sgms2 can be produced using various expression systems. The following table summarizes common expression platforms used for producing this protein:

Expression SystemAdvantagesConsiderations
Bacterial (E. coli)High yield, cost-effectiveMay lack proper post-translational modifications
Mammalian cellsProper folding and modificationsLower yield, more expensive
Insect cellsGood compromise between yield and modificationsModerate complexity
YeastModerate yield with some eukaryotic modificationsMay have different glycosylation patterns

The choice of expression system depends on the intended application and the specific requirements for protein activity and modifications .

Purification Methods

Purification of recombinant rat Sgms2 typically involves several steps:

  1. Cell lysis to release the protein

  2. Affinity chromatography using tags determined during the production process

  3. Protein G purification for antibody applications

  4. Quality control to ensure >95% purity

For optimal results, the protein is often maintained in a Tris-based buffer with 50% glycerol during and after purification .

Quality Control and Validation

Quality control of recombinant rat Sgms2 involves:

  • Verification of protein identity through mass spectrometry or Western blotting

  • Assessment of purity through SDS-PAGE

  • Functional assays to confirm enzymatic activity

  • Validation of applications such as ELISA, Western blot, and immunohistochemistry

These quality control measures ensure that the recombinant protein meets the necessary standards for research applications .

ELISA Kits

ELISA kits utilizing recombinant rat Sgms2 are valuable tools for quantitative measurement of Sgms2 in various biological samples. Based on available data, these kits typically offer the following specifications:

ParameterSpecification
Assay TypeSandwich enzyme immunoassay
Detection Range0.32-20 ng/mL
Sensitivity<0.156 ng/mL
Sample TypesSerum, plasma, cell culture supernatants, tissue homogenates
Intra-Assay PrecisionCV<10%
Inter-Assay PrecisionCV<15%
Recovery (Serum)90% (89-91%)
Recovery (Cell Culture Media)89% (84-100%)

The procedure for these ELISA kits typically involves:

  1. Sample preparation according to the source material

  2. Incubation with capture antibodies

  3. Addition of detection antibodies and enzyme conjugates

  4. Colorimetric detection and measurement at 450nm

Antibodies Against Rat Sgms2

Several antibodies against rat Sgms2 are available for research purposes. These include:

Antibody TypeHostApplicationsRecommended DilutionsReactivity
PolyclonalRabbitWB, IHC-P, ICC/IFWB: 1:500-1:5000, IHC: 1:500-1:1000, IF: 1:200-1:500Rat, Human
MonoclonalMouseWB, ELISAVaries by manufacturerHuman, Rat

These antibodies serve as valuable tools for detecting and studying Sgms2 in various experimental contexts .

Functional Studies

Recombinant rat Sgms2 has been instrumental in various functional studies investigating:

  • Enzymatic mechanisms of sphingomyelin synthesis

  • Structure-function relationships of sphingomyelin synthases

  • Roles of Sgms2 in cellular signaling pathways

  • Effects of Sgms2 modulation on disease models

These studies have provided valuable insights into the physiological roles of Sgms2 and its potential as a therapeutic target .

Bone Development and Metabolism

Sgms2 plays a critical role in bone development and metabolism. Studies have shown high expression of Sgms2 in cortical bone, vertebrae, kidney, and liver in murine models . In vitro studies have demonstrated that murine osteoblasts, bone marrow macrophages, and osteoclasts express Sgms2 at similar levels .

The importance of Sgms2 in bone development is underscored by the finding that pathogenic variants in human SGMS2 cause a rare skeletal disorder characterized by calvarial doughnut lesions with bone fragility (CDL) . This condition is associated with low bone mineral density, neonatal fractures, long-bone deformities, and short stature.

The relationship between Sgms2 and bone metabolism appears to involve:

  • Regulation of osteoblast function and bone matrix mineralization

  • Potential influences on osteoclastogenesis through the 1,25(OH)₂D pathway

  • Effects on cellular lipid distributions crucial for bone formation

Neurological Functions

In addition to skeletal effects, Sgms2 has important neurological functions. Patients with SGMS2 mutations often experience neurological manifestations, particularly transitory, spontaneously resolving, and recurrent cranial nerve palsies, with facial nerve palsy being the most common .

The neurological role of Sgms2 likely relates to:

  • Sphingomyelin's importance in myelin sheaths that insulate nerve fibers

  • Regulation of lipid rafts that serve as platforms for neuronal signaling

  • Potential influences on neuronal apoptosis through modulation of ceramide levels

These neurological manifestations highlight the diverse physiological roles of Sgms2 beyond bone metabolism .

Other Physiological Functions

Sgms2 is involved in various other physiological processes, including:

  • Cell growth regulation

  • Apoptosis modulation

  • Inflammatory responses

  • Respiratory function

In a study of airway resistance, Sgms2 knockout mice showed greater AKT phosphorylation, peribronchial collagen deposition, and protease activity in their lungs after smoke inhalation, suggesting a protective role of Sgms2 in respiratory health . These diverse functions reflect the importance of proper sphingolipid metabolism in multiple physiological systems.

SGMS2-Related Osteoporosis

Pathogenic variants in the SGMS2 gene cause a rare form of osteoporosis with distinct clinical features. The table below summarizes the known pathogenic variants and their associated phenotypes:

VariantTypeEffect on ProteinClinical PhenotypeSeverity
p.Arg50*NonsenseTruncated enzyme lacking transmembrane helices and active sitesCDL, childhood-onset osteoporosis, recurrent cranial nerve palsiesMild
p.Ile62SerMissenseRetained in ER, cannot reach plasma membraneCDL, spondylometaphyseal dysplasia, neonatal fractures, severe short statureSevere
p.Met64ArgMissenseRetained in ER, cannot reach plasma membraneCDL, spondylometaphyseal dysplasia, neonatal fractures, severe short statureSevere

Interestingly, these pathogenic variants do not necessarily reduce the enzymatic activity of Sgms2, but rather affect its subcellular localization . The missense variants cause retention of the enzyme in the endoplasmic reticulum due to disruption of an ER export signal, while the p.Arg50* variant is predicted to result in a truncated enzyme lacking the entire transmembrane helices and active sites .

Cancer and Metastasis

Sgms2 has been implicated in cancer progression and metastasis. A study on breast cancer demonstrated that high SGMS2 expression is associated with breast cancer metastasis . Functional assays revealed that SGMS2:

  • Promotes cancer cell proliferation by suppressing apoptosis through a ceramide-associated pathway

  • Enhances cancer cell invasiveness by promoting epithelial-to-mesenchymal transition (EMT) through the TGF-β/Smad signaling pathway

  • Activates the TGF-β/Smad signaling pathway by increasing TGF-β1 secretion

These findings suggest that Sgms2 may be a potential therapeutic target for breast cancer treatment.

Respiratory Disorders

Studies have also implicated Sgms2 in respiratory disorders. Sgms2 knockout mice exhibited greater AKT phosphorylation, peribronchial collagen deposition, and protease activity in their lungs after smoke inhalation . Similar changes were observed in human bronchial epithelial cells isolated from subjects with chronic obstructive pulmonary disease (COPD), which showed reduced SGMS2 expression and enhanced phosphorylation of AKT and protease production .

Selective inhibition of AKT activity or overexpression of SGMS2 reduced the production of matrix metalloproteinases in bronchial epithelial cells and monocyte-derived macrophages, suggesting potential therapeutic approaches for COPD targeting this pathway .

Sequence Homology and Conservation

Rat Sgms2 shares significant sequence homology with human SGMS2. Comparative analysis reveals high conservation of key functional domains, particularly:

  • The N-terminal region containing the ER export signal

  • Transmembrane domains

  • Catalytic sites responsible for enzymatic activity

This conservation is especially pronounced in the region immediately upstream of the first transmembrane domain (TMD1), which contains the IXMP motif that functions as an ER export signal . The conservation extends across various species, including mouse and zebrafish, highlighting the evolutionary importance of this protein.

Functional Comparison

Both rat Sgms2 and human SGMS2 function primarily as sphingomyelin synthases at the plasma membrane. They catalyze the bidirectional transfer of phosphocholine between phosphatidylcholine and ceramide, and both can also transfer phosphoethanolamine to form ceramide phosphoethanolamine .

The subcellular localization patterns are also similar, with both proteins primarily localizing to the plasma membrane with some presence in the Golgi apparatus. This similarity in function and localization makes rat Sgms2 a valuable model for studying human SGMS2 in both normal physiology and pathological conditions .

Therapeutic Potential

The involvement of Sgms2 in various pathological conditions suggests several potential therapeutic applications:

  1. For SGMS2-related osteoporosis:

    • Development of therapies targeting proper trafficking of mutant SGMS2 proteins

    • Approaches to correct lipid distributions in osteogenic cells

  2. For cancer treatment:

    • SGMS2 inhibitors to modulate ceramide levels and promote apoptosis in cancer cells

    • Therapies targeting the SGMS2-mediated TGF-β/Smad signaling pathway

  3. For respiratory disorders:

    • SGMS2 activators or overexpression strategies to reduce protease activity and inflammation

These therapeutic approaches require further research to understand the precise mechanisms of Sgms2 in these pathological conditions .

Research Challenges and Opportunities

Despite significant advances, several challenges remain in Sgms2 research:

  • Determining the three-dimensional structure of the protein

  • Understanding the precise mechanisms of substrate recognition and catalysis

  • Elucidating the regulation of Sgms2 expression in different tissues

  • Developing specific inhibitors or activators for therapeutic purposes

  • Investigating the potential of Sgms2 as a biomarker for disease diagnosis or prognosis

Addressing these challenges presents opportunities for innovative research approaches, including:

  • Advanced imaging techniques to study Sgms2 localization and trafficking

  • CRISPR-Cas9 technology to generate and study Sgms2 variants

  • Lipidomic approaches to understand the broader impact of Sgms2 on cellular lipid profiles

  • Development of cell and animal models to study Sgms2-related diseases

Definition and Nomenclature

Phosphatidylcholine:ceramide cholinephosphotransferase 2 (Sgms2), also known as Sphingomyelin Synthase 2, is an enzyme that catalyzes the reversible transfer of phosphocholine from phosphatidylcholine to ceramide, resulting in the formation of sphingomyelin and diacylglycerol . This enzyme is classified under EC 2.7.8.27 and represents one of the two functional sphingomyelin synthases identified in mammals, the other being Sphingomyelin Synthase 1 (Sgms1) .

Physical and Biochemical Properties

As a recombinant protein, rat Sgms2 is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . The recommended storage conditions are -20°C for regular use and -20°C to -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week . The protein exhibits optimal activity at physiological pH and temperature.

Catalytic Mechanism

Sgms2 functions as a bidirectional transferase that catalyzes two main reactions:

  1. Forward reaction: Transfers the phosphocholine head group from phosphatidylcholine (PC) to ceramide (CER), producing sphingomyelin (SM) and diacylglycerol (DAG) as a by-product .

  2. Reverse reaction: Transfers phosphocholine from sphingomyelin to diacylglycerol, producing phosphatidylcholine and ceramide .

The direction of the reaction is largely dependent on the relative concentrations of ceramide and diacylglycerol in the membrane . Importantly, Sgms2 does not utilize free phosphorylcholine or CDP-choline as donors, requiring phospholipids with two fatty chains on the choline-phosphate donor molecule for efficient substrate recognition .

Substrate Specificity

Sgms2 exhibits specific substrate preferences. Studies have shown that it efficiently recognizes phosphatidylcholine as a substrate but can also use sphingomyelin itself as a donor of the phosphocholine group . Interestingly, Sgms2 can also transfer the phosphoethanolamine head group from phosphatidylethanolamine (PE) to ceramide, forming ceramide phosphoethanolamine (CPE) .

Research has demonstrated that non-choline phospholipids such as phosphatidylethanolamine (PE), phosphatidylinositol (PI), phosphatidylserine (PS), phosphatidic acid (PA), and phosphatidylglycerol (PG) are not utilized as substrates for sphingomyelin formation .

Cellular Localization and Function

While Sgms1 is primarily localized in the Golgi apparatus, Sgms2 primarily contributes to sphingomyelin synthesis and homeostasis at the plasma membrane . This differential localization suggests distinct physiological roles for the two sphingomyelin synthases.

Sgms2 regulates receptor-mediated signal transduction through multiple mechanisms:

  • Modulating levels of mitogenic diacylglycerol

  • Influencing proapoptotic ceramide

  • Maintaining sphingomyelin levels in membrane rafts that serve as platforms for signal transduction and protein sorting

Additionally, Sgms2 plays a role in secretory transport via regulation of the diacylglycerol pool at the Golgi apparatus and its downstream effects on protein kinase D1 (PRKD1) .

Expression Systems

Recombinant rat Sgms2 can be produced using various expression systems. The following table summarizes common expression platforms used for producing this protein:

Expression SystemAdvantagesConsiderations
Bacterial (E. coli)High yield, cost-effectiveMay lack proper post-translational modifications
Mammalian cellsProper folding and modificationsLower yield, more expensive
Insect cellsGood compromise between yield and modificationsModerate complexity
YeastModerate yield with some eukaryotic modificationsMay have different glycosylation patterns

The choice of expression system depends on the intended application and the specific requirements for protein activity and modifications .

Purification Methods

Purification of recombinant rat Sgms2 typically involves several steps:

  1. Cell lysis to release the protein

  2. Affinity chromatography using tags determined during the production process

  3. Protein G purification for antibody applications

  4. Quality control to ensure >95% purity

For optimal results, the protein is often maintained in a Tris-based buffer with 50% glycerol during and after purification .

Quality Control and Validation

Quality control of recombinant rat Sgms2 involves:

  • Verification of protein identity through mass spectrometry or Western blotting

  • Assessment of purity through SDS-PAGE

  • Functional assays to confirm enzymatic activity

  • Validation of applications such as ELISA, Western blot, and immunohistochemistry

These quality control measures ensure that the recombinant protein meets the necessary standards for research applications .

ELISA Kits

ELISA kits utilizing recombinant rat Sgms2 are valuable tools for quantitative measurement of Sgms2 in various biological samples. Based on available data, these kits typically offer the following specifications:

ParameterSpecification
Assay TypeSandwich enzyme immunoassay
Detection Range0.32-20 ng/mL
Sensitivity<0.156 ng/mL
Sample TypesSerum, plasma, cell culture supernatants, tissue homogenates
Intra-Assay PrecisionCV<10%
Inter-Assay PrecisionCV<15%
Recovery (Serum)90% (89-91%)
Recovery (Cell Culture Media)89% (84-100%)

The procedure for these ELISA kits typically involves:

  1. Sample preparation according to the source material

  2. Incubation with capture antibodies

  3. Addition of detection antibodies and enzyme conjugates

  4. Colorimetric detection and measurement at 450nm

Antibodies Against Rat Sgms2

Several antibodies against rat Sgms2 are available for research purposes. These include:

Antibody TypeHostApplicationsRecommended DilutionsReactivity
PolyclonalRabbitWB, IHC-P, ICC/IFWB: 1:500-1:5000, IHC: 1:500-1:1000, IF: 1:200-1:500Rat, Human
MonoclonalMouseWB, ELISAVaries by manufacturerHuman, Rat

These antibodies serve as valuable tools for detecting and studying Sgms2 in various experimental contexts .

Functional Studies

Recombinant rat Sgms2 has been instrumental in various functional studies investigating:

  • Enzymatic mechanisms of sphingomyelin synthesis

  • Structure-function relationships of sphingomyelin synthases

  • Roles of Sgms2 in cellular signaling pathways

  • Effects of Sgms2 modulation on disease models

These studies have provided valuable insights into the physiological roles of Sgms2 and its potential as a therapeutic target .

Bone Development and Metabolism

Sgms2 plays a critical role in bone development and metabolism. Studies have shown high expression of Sgms2 in cortical bone, vertebrae, kidney, and liver in murine models . In vitro studies have demonstrated that murine osteoblasts, bone marrow macrophages, and osteoclasts express Sgms2 at similar levels .

The importance of Sgms2 in bone development is underscored by the finding that pathogenic variants in human SGMS2 cause a rare skeletal disorder characterized by calvarial doughnut lesions with bone fragility (CDL) . This condition is associated with low bone mineral density, neonatal fractures, long-bone deformities, and short stature.

The relationship between Sgms2 and bone metabolism appears to involve:

  • Regulation of osteoblast function and bone matrix mineralization

  • Potential influences on osteoclastogenesis through the 1,25(OH)₂D pathway

  • Effects on cellular lipid distributions crucial for bone formation

Neurological Functions

In addition to skeletal effects, Sgms2 has important neurological functions. Patients with SGMS2 mutations often experience neurological manifestations, particularly transitory, spontaneously resolving, and recurrent cranial nerve palsies, with facial nerve palsy being the most common .

The neurological role of Sgms2 likely relates to:

  • Sphingomyelin's importance in myelin sheaths that insulate nerve fibers

  • Regulation of lipid rafts that serve as platforms for neuronal signaling

  • Potential influences on neuronal apoptosis through modulation of ceramide levels

These neurological manifestations highlight the diverse physiological roles of Sgms2 beyond bone metabolism .

Other Physiological Functions

Sgms2 is involved in various other physiological processes, including:

  • Cell growth regulation

  • Apoptosis modulation

  • Inflammatory responses

  • Respiratory function

In a study of airway resistance, Sgms2 knockout mice showed greater AKT phosphorylation, peribronchial collagen deposition, and protease activity in their lungs after smoke inhalation, suggesting a protective role of Sgms2 in respiratory health . These diverse functions reflect the importance of proper sphingolipid metabolism in multiple physiological systems.

SGMS2-Related Osteoporosis

Pathogenic variants in the SGMS2 gene cause a rare form of osteoporosis with distinct clinical features. The table below summarizes the known pathogenic variants and their associated phenotypes:

VariantTypeEffect on ProteinClinical PhenotypeSeverity
p.Arg50*NonsenseTruncated enzyme lacking transmembrane helices and active sitesCDL, childhood-onset osteoporosis, recurrent cranial nerve palsiesMild
p.Ile62SerMissenseRetained in ER, cannot reach plasma membraneCDL, spondylometaphyseal dysplasia, neonatal fractures, severe short statureSevere
p.Met64ArgMissenseRetained in ER, cannot reach plasma membraneCDL, spondylometaphyseal dysplasia, neonatal fractures, severe short statureSevere

Interestingly, these pathogenic variants do not necessarily reduce the enzymatic activity of Sgms2, but rather affect its subcellular localization . The missense variants cause retention of the enzyme in the endoplasmic reticulum due to disruption of an ER export signal, while the p.Arg50* variant is predicted to result in a truncated enzyme lacking the entire transmembrane helices and active sites .

Cancer and Metastasis

Sgms2 has been implicated in cancer progression and metastasis. A study on breast cancer demonstrated that high SGMS2 expression is associated with breast cancer metastasis . Functional assays revealed that SGMS2:

  • Promotes cancer cell proliferation by suppressing apoptosis through a ceramide-associated pathway

  • Enhances cancer cell invasiveness by promoting epithelial-to-mesenchymal transition (EMT) through the TGF-β/Smad signaling pathway

  • Activates the TGF-β/Smad signaling pathway by increasing TGF-β1 secretion

These findings suggest that Sgms2 may be a potential therapeutic target for breast cancer treatment.

Respiratory Disorders

Studies have also implicated Sgms2 in respiratory disorders. Sgms2 knockout mice exhibited greater AKT phosphorylation, peribronchial collagen deposition, and protease activity in their lungs after smoke inhalation . Similar changes were observed in human bronchial epithelial cells isolated from subjects with chronic obstructive pulmonary disease (COPD), which showed reduced SGMS2 expression and enhanced phosphorylation of AKT and protease production .

Selective inhibition of AKT activity or overexpression of SGMS2 reduced the production of matrix metalloproteinases in bronchial epithelial cells and monocyte-derived macrophages, suggesting potential therapeutic approaches for COPD targeting this pathway .

Sequence Homology and Conservation

Rat Sgms2 shares significant sequence homology with human SGMS2. Comparative analysis reveals high conservation of key functional domains, particularly:

  • The N-terminal region containing the ER export signal

  • Transmembrane domains

  • Catalytic sites responsible for enzymatic activity

This conservation is especially pronounced in the region immediately upstream of the first transmembrane domain (TMD1), which contains the IXMP motif that functions as an ER export signal . The conservation extends across various species, including mouse and zebrafish, highlighting the evolutionary importance of this protein.

Functional Comparison

Both rat Sgms2 and human SGMS2 function primarily as sphingomyelin synthases at the plasma membrane. They catalyze the bidirectional transfer of phosphocholine between phosphatidylcholine and ceramide, and both can also transfer phosphoethanolamine to form ceramide phosphoethanolamine .

The subcellular localization patterns are also similar, with both proteins primarily localizing to the plasma membrane with some presence in the Golgi apparatus. This similarity in function and localization makes rat Sgms2 a valuable model for studying human SGMS2 in both normal physiology and pathological conditions .

Therapeutic Potential

The involvement of Sgms2 in various pathological conditions suggests several potential therapeutic applications:

  1. For SGMS2-related osteoporosis:

    • Development of therapies targeting proper trafficking of mutant SGMS2 proteins

    • Approaches to correct lipid distributions in osteogenic cells

  2. For cancer treatment:

    • SGMS2 inhibitors to modulate ceramide levels and promote apoptosis in cancer cells

    • Therapies targeting the SGMS2-mediated TGF-β/Smad signaling pathway

  3. For respiratory disorders:

    • SGMS2 activators or overexpression strategies to reduce protease activity and inflammation

These therapeutic approaches require further research to understand the precise mechanisms of Sgms2 in these pathological conditions .

Research Challenges and Opportunities

Despite significant advances, several challenges remain in Sgms2 research:

  • Determining the three-dimensional structure of the protein

  • Understanding the precise mechanisms of substrate recognition and catalysis

  • Elucidating the regulation of Sgms2 expression in different tissues

  • Developing specific inhibitors or activators for therapeutic purposes

  • Investigating the potential of Sgms2 as a biomarker for disease diagnosis or prognosis

Addressing these challenges presents opportunities for innovative research approaches, including:

  • Advanced imaging techniques to study Sgms2 localization and trafficking

  • CRISPR-Cas9 technology to generate and study Sgms2 variants

  • Lipidomic approaches to understand the broader impact of Sgms2 on cellular lipid profiles

  • Development of cell and animal models to study Sgms2-related diseases

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Sgms2; Phosphatidylcholine:ceramide cholinephosphotransferase 2; Sphingomyelin synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sgms2
Target Protein Sequence
MDIIETAKLEGHLESQTNNSTNTYTSPTEAVEEEDKNGKGKPKTLSNGLRKGAKKYPDYI QISMPNDSRNKLPLEWWKTGIAFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDY VDRVKWAFSVSEINGMVLVGLWLTQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLP VPGMHFQCAPKLNGDSQAKIQRILRLLSGGGLSITGSHILCGDFLFSGHTVVLTLTYLFI KEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNL KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED NEKST
Uniprot No.

Target Background

Function
Sphingomyelin synthase 2 (Sgms2) primarily contributes to sphingomyelin synthesis and homeostasis at the plasma membrane. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis. In the forward reaction, it transfers the phosphocholine head group of phosphatidylcholine (PC) to ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as a by-product. Conversely, in the reverse reaction, it transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction appears to be influenced by the levels of CER and DAG in the plasma membrane. Sgms2 does not utilize free phosphorylcholine or CDP-choline as donors. Additionally, it can transfer the phosphoethanolamine head group of phosphatidylethanolamine (PE) to ceramide (CER) to form ceramide phosphoethanolamine (CPE). Sgms2 regulates receptor-mediated signal transduction through mitogenic DAG and proapoptotic CER, as well as through SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting. To a lesser extent, it plays a role in secretory transport by regulating the DAG pool at the Golgi apparatus and its downstream effects on PRKD1. Sgms2 is essential for normal bone matrix mineralization.
Gene References Into Functions
  1. In contrast to Sgms1, Sgms2 lacks the multi-exon 5'-UTR but encodes circRNAs, which are composed of the coding region of the gene and are expressed at a low level. PMID: 29294205
  2. SMS1 and SMS2 are capable of regulating TGN-mediated protein trafficking and secretion. PMID: 21980337
Database Links
Protein Families
Sphingomyelin synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expression restricted to late round spermatids and elongating spermatids but not detected in late elongate spermatids and Sertoli cells (at protein level).

Q&A

What is the basic function of Sgms2 in cellular membranes?

Sgms2 (sphingomyelin synthase 2) is an integral membrane protein that catalyzes the transfer of phosphocholine from phosphatidylcholine (PC) to ceramide, producing sphingomyelin (SM) and diacylglycerol (DAG). This enzyme functions primarily at the plasma membrane, playing a crucial role in sphingolipid metabolism and membrane structure maintenance .

Methodologically, when studying Sgms2 function, researchers should consider that:

  • SMS2 recognizes the choline head group on its substrates with high specificity

  • The enzyme requires two fatty chains on the choline-phosphate donor molecule for efficient substrate recognition

  • SMS2 can function bidirectionally, transferring phosphocholine between ceramide and DAG depending on their relative concentrations

How does the structure of Sgms2 relate to its cellular localization and function?

Sgms2 is a multi-membrane spanning protein with several transmembrane domains. The N-terminal region contains critical motifs for proper subcellular localization. Specifically:

  • The protein contains a conserved sequence motif, IXMP, located 13-14 residues upstream of the first membrane span, which functions as an ER export signal

  • Motifs D3 (C-G-D-X3-S-G-H-L) and D4 (H-Y-T-X-D-V-X3-Y-X6-F-X2-H) are similar to C2 and C3 motifs in lipid phosphate phosphatases and include histidine and aspartate residues that form a catalytic triad

  • These catalytic residues are juxtaposed to transmembrane segments 4 and 6 and oriented toward the same side of the membrane

For effective research on Sgms2 structure-function relationships, experimental approaches should include site-directed mutagenesis of these key motifs coupled with subcellular localization studies and enzymatic activity assays.

What are the most effective methods for expressing and purifying recombinant Sgms2 protein?

For optimal expression and purification of recombinant rat Sgms2:

  • Expression Systems: E. coli has been successfully used for full-length rat Sgms1 (1-419aa) expression with N-terminal His tags

  • Purification Strategy:

    • Use affinity chromatography with Ni-NTA resin for His-tagged proteins

    • Prepare in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Lyophilize the purified protein for long-term storage

Reconstitution Protocol:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

What enzymatic assay methods are most reliable for measuring Sgms2 activity in vitro?

Several methodologies have been validated for measuring Sgms2 enzymatic activity:

  • Fluorescent Substrate Assay:

    • Incubate cell lysates or purified enzyme with fluorescent C6-NBD-ceramide

    • Monitor formation of NBD-SM by thin-layer chromatography (TLC)

    • For quantitative analysis, spots can be scraped and fluorescence measured by spectrofluorometry

  • Radiolabeled Substrate Assay:

    • Use PC containing [³H]-choline as substrate

    • Measure formation of radiolabeled SM

    • This method confirms direct transfer of the choline head group

  • Mass Spectrometry-Based Assay:

    • Incubate enzyme with natural ceramides (e.g., bovine brain ceramides)

    • Analyze SM formation by ESI-MS

    • This approach verifies activity with physiologically relevant substrates

For reliable results, dilution of extracts may be necessary to render SMS-mediated synthesis dependent on externally added head group donors .

How do pathogenic variants in SGMS2 lead to skeletal disorders, and what research models best capture these effects?

Heterozygous variants in SGMS2 cause a rare monogenic form of osteoporosis known as calvarial doughnut lesions with bone fragility (CDL). The pathophysiological mechanisms include:

  • Mislocalization of SMS2 Protein:

    • p.Ile62Ser and p.Met64Arg variants cause SMS2 retention in the ER due to disruption of the ER export signal

    • The p.Arg50* variant likely mislocalizes to the cis/medial Golgi

  • Disrupted Sphingomyelin Distribution:

    • The disease results from improperly targeted bulk SM production rather than decreased SM synthesis

    • This leads to altered subcellular organization of SM and cholesterol

    • Changes in ER glycerophospholipid profiles, including increased phospholipid desaturation, may be cellular adaptations to SM-mediated rigidification of the ER bilayer

Research Models:

  • Sms2 knockout mice exist but may not exhibit obvious bone abnormalities

  • Zebrafish knockdown models of sgms2a, sgms2b, and sgms2a+b show defective cartilage and early skeletal element development

  • For accurate disease modeling, knockin models with specific pathogenic variants may be necessary

What molecular mechanisms link sphingomyelin metabolism to bone formation and strength?

The connection between SM metabolism and bone strength involves several potential mechanisms:

  • Collagen Export and Bone Matrix Formation:

    • Pathogenic SMS2 variants may affect lipid composition of secretory organelles, preventing proper export of collagen from the ER

    • Bone biopsies from patients with SGMS2 mutations show discorded collagenous apposition and distorted lacuna-canalicular networks

  • Bone Mineralization:

    • Disrupted SM asymmetry at the plasma membrane of osteogenic cells may affect bone mineralization

    • Cytosolically exposed SM may be prematurely converted to ceramide, diminishing matrix vesicle formation

    • This may hamper continuous supply of phosphocholine required for normal bone mineralization

  • Cellular Adaptation:

    • Changes in SM and other phospholipids alter membrane properties along the secretory pathway

    • This may impair the ability of osteogenic cells to maintain nonrandom lipid distributions essential for bone formation

How do Sgms2 knockout mice differ from humans with SGMS2 mutations, and what explains these differences?

Several key differences exist between Sgms2 knockout mice and humans with SGMS2 mutations:

  • Phenotypic Discrepancies:

    • Sgms2 KO mice show no obvious bone abnormalities, while humans with SGMS2 mutations have severe skeletal disorders

    • KO mice exhibit reduced diet-induced obesity and insulin resistance

    • KO mice display diminished NFκB response to inflammatory stimuli

  • Potential Explanations:

    • Complete removal of Sgms2 may be insufficient to cause bone phenotypes since SMS1 can also produce SM

    • Human pathogenic variants cause protein mislocalization rather than complete absence

    • Species-specific differences in SM metabolism and bone development pathways

    • Compensation mechanisms may differ between complete knockout and dominant negative effects

Methodological implications: To better model human disease, consider:

  • Creating knockin models with specific pathogenic variants

  • Using conditional knockout systems to study tissue-specific and temporal effects

  • Employing complementary models like zebrafish that show skeletal phenotypes with sgms2 knockdown

What are the strengths and limitations of various animal models for studying Sgms2 function in bone development?

Different animal models offer complementary advantages for Sgms2 research:

  • Mouse Models:

    • Strengths: Mammalian bone development, established genetic manipulation techniques, similar skeletal elements to humans

    • Limitations: Sgms2 KO mice lack obvious bone phenotypes, differences in bone remodeling rates compared to humans

    • Applications: Metabolic studies, tissue-specific conditional knockouts, lifespan studies

  • Zebrafish Models:

    • Strengths: Rapid development, transparent embryos allowing real-time imaging, efficient genetic manipulation

    • Limitations: Two orthologues (sgms2a, sgms2b) requiring dual manipulation, differences in bone morphology from mammals

    • Applications: Early development studies, high-throughput screening, behavior analysis

    • Research shows knockdown of sgms2a, sgms2b, and sgms2a+b results in defective cartilage and early skeletal element development

  • Rat Models:

    • Strengths: Larger size allowing more tissue collection, intermediate between mice and humans

    • Limitations: Fewer genetic tools, although improving with CRISPR technology

    • Applications: Pharmacological studies, surgical interventions, PDX models

    • Immunodeficient SRG rat has been developed for oncology studies

For comprehensive Sgms2 skeletal research, consider combining models to capitalize on their respective strengths.

How does SMS2 differentially regulate ceramide levels across subcellular compartments, and what techniques can reveal these dynamics?

SMS2 plays a complex role in regulating ceramide levels across cellular compartments:

  • Compartment-Specific Regulation:

    • SMS2 primarily functions at the plasma membrane, while SMS1 operates in the Golgi

    • Mislocalization of SMS2 due to pathogenic variants affects the SM/ceramide balance in the ER, Golgi, and plasma membrane

    • SMS2 can function bidirectionally, potentially converting SM back to ceramide depending on cellular conditions

  • Advanced Techniques for Studying Subcellular Sphingolipid Dynamics:

    • Live-cell imaging using fluorescent sphingolipid probes and SMS2-fluorescent protein fusions

    • Subcellular fractionation combined with lipidomic analysis (LC-MS/MS)

    • Super-resolution microscopy with sphingolipid-specific antibodies or probes

    • Proximity labeling techniques (BioID, APEX) to identify compartment-specific SMS2 interactors

    • FRET-based sensors for real-time monitoring of sphingolipid metabolism

  • Research Considerations:

    • Account for lipid redistribution during sample preparation

    • Validate findings using complementary approaches

    • Consider the impact of SM pool sizes on interpretation of experimental results

What is the interplay between SMS2-mediated sphingomyelin synthesis and TGF-β signaling in disease contexts?

The relationship between SMS2 activity and TGF-β signaling represents an important area for advanced research:

  • Mechanism of Interaction:

    • SMS2 upregulation increases SM expression

    • SM is involved in regulation of cell secretory activity

    • SMS2 can promote TGF-β1 secretion by upregulating SM expression

    • Aberrant upregulation of SGMS2 disrupts the homeostasis of ceramide and SM, potentially activating the TGF-β/Smad pathway

  • Disease Relevance:

    • In breast cancer, SGMS2 upregulation may activate the Cer-associated apoptosis pathway and TGF-β/Smad pathway

    • In osteoporosis, altered TGF-β signaling could contribute to bone formation defects

    • In neurological conditions, SM-dependent TGF-β signaling might influence neural development and function

  • Methodological Approaches:

    • Use of SMase inhibitors or SM supplementation to dissect specific roles of SM in TGF-β pathway activation

    • Phospho-SMAD immunoblotting to assess pathway activation state

    • ELISA assays to measure TGF-β1 secretion in response to SMS2 manipulation

    • ChIP-seq to identify TGF-β-responsive genes affected by SMS2 activity

    • Co-immunoprecipitation to detect potential physical interactions between SM-rich membrane domains and TGF-β receptors

How can therapeutic approaches targeting SMS2 be developed for SGMS2-related skeletal disorders?

Development of therapeutics for SGMS2-related disorders requires innovative approaches:

  • Potential Therapeutic Strategies:

    • Small molecules that correct mislocalization of mutant SMS2

    • Peptide-based therapies mimicking the functional domains of SMS2

    • RNA-based therapies (antisense oligonucleotides, siRNA) to modulate expression of mutant SGMS2

    • Enzyme replacement or gene therapy approaches

    • Targeting downstream effects on bone formation and mineralization

  • Drug Discovery Pipeline:

    • High-throughput screening using cell lines expressing mutant SMS2

    • Validation in patient-derived fibroblasts or induced pluripotent stem cells (iPSCs)

    • Testing in sgms2 mutant zebrafish models before advancing to mammalian models

    • Evaluation of effects on SM distribution, ceramide levels, and bone cell function

  • Translational Considerations:

    • Phenotypic variability among patients with different SGMS2 variants may require mutation-specific approaches

    • SM metabolism is involved in multiple physiological processes, necessitating careful assessment of off-target effects

    • Development of biomarkers to monitor treatment efficacy

    • Potential broader applications for other forms of osteoporosis in the general population

How do sphingomyelin synthases differ across species, and what insights can be gained from these differences?

Evolutionary analysis of sphingomyelin synthases reveals important insights:

  • Cross-Species Comparison:

    • Mammals have two SMS isoforms (SMS1 and SMS2)

    • C. elegans contains multiple SMS genes

    • Drosophila lacks SM and instead synthesizes ceramide phosphoethanolamine (CPE) as its principal sphingolipid

    • Zebrafish have two Sgms2 orthologues (sgms2a and sgms2b)

  • Functional Conservation and Divergence:

    • The catalytic domains are highly conserved across species

    • The N-terminal regions show greater variability, affecting subcellular localization

    • Human SMS1 and SMS2 share 57% sequence identity

    • Human-mouse conservation for SMS proteins is >90%

  • Research Applications:

    • Study of simpler organisms like C. elegans can reveal fundamental aspects of sphingolipid metabolism

    • Cross-species rescue experiments can identify functionally conserved domains

    • Comparison of species that do and don't develop specific pathologies can provide insight into disease mechanisms

    • Evolutionary analysis can identify critical residues that may be targets for therapeutic intervention

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.