Recombinant Rat Phosphatidylinositide phosphatase SAC1 (Sacm1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sacm1l; Sac1; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAATAYEHLKLHITPEKFYVEACDDGADDVLIIDRVSTEVTLAVKKDVPPSAVTRPIYGI MGTIHLVAGNYLVVITKKMKVGEFFNHVIWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA MLNHVLSTDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYSGNRASFVQTRGSIPVFWSQRPNLKYKPDPQINKVANHMDGFQRHFDSQVIIYG KQVIINLVNHKGSEKPLEQTFAKMVSSLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDSAGKVVTNQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLVMDGFNSLLR YYKNNFSDGFRQDSIDLFLGNYSVDELDSHSPLSVPRDWKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
Uniprot No.

Target Background

Function

Recombinant Rat Phosphatidylinositide phosphatase SAC1 (Sacm1l) is a phosphoinositide phosphatase that catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). The enzyme demonstrates robust PtdIns(4)P phosphatase activity when bound to PtdIns(4)P in a 'cis' configuration within the cellular environment. Significantly less activity is observed with 'trans' configuration binding. PtdIns(4)P phosphatase activity (in the 'trans' configuration) is enhanced by the presence of PLEKHA3.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in spleen, lung, liver, skeletal muscle, kidney, testis and in cerebellar Purkinje cells (at protein level). Ubiquitous. Highly expressed in brain, spleen, liver and kidney.

Q&A

What is the primary function of Rat Phosphatidylinositide phosphatase SAC1 (Sacm1l)?

Rat Phosphatidylinositide phosphatase SAC1 (Sacm1l) is a transmembrane phosphoinositide phosphatase that primarily catalyzes the dephosphorylation of phosphatidylinositol-4-phosphate (PI(4)P). It is critically involved in several cellular processes including neurotransmitter receptor transport to postsynaptic membrane, phosphatidylinositol dephosphorylation, and vesicle-mediated transport in synapses . SAC1 is an essential regulator of membrane phosphoinositide composition and plays a crucial role in maintaining phosphoinositide homeostasis within the endoplasmic reticulum (ER) and Golgi compartments. The protein has been demonstrated to function primarily as a 'cis'-acting enzyme, meaning it dephosphorylates PI(4)P substrates present in the same membrane where SAC1 is located, rather than acting across different membrane compartments .

What is the subcellular localization pattern of SAC1?

SAC1 is predominantly localized to the endoplasmic reticulum (ER) and Golgi apparatus as a transmembrane protein. Despite theories suggesting potential enrichment at membrane contact sites (MCS), particularly ER-plasma membrane contact sites, research has shown that SAC1 is not significantly enriched at these regions under normal physiological conditions . Its localization is critical for its function in regulating phosphoinositide metabolism, as it can only act on substrates within its resident membranes due to its limited 'reach' of approximately 7 nm . When studying SAC1 localization, researchers should use appropriate membrane markers for co-localization studies, including ER markers (e.g., calnexin) and Golgi markers (e.g., GM130), alongside SAC1-specific antibodies or tagged SAC1 constructs.

How does SAC1 catalytic activity regulate autophagy and bacterial infections?

SAC1 plays a crucial role in xenophagy, an autophagy-based innate defense mechanism against intracellular bacterial pathogens. The phosphatase activity of SAC1 is essential for restricting intracellular bacterial replication, as demonstrated by experiments with Salmonella Typhimurium. SAC1 knockout (KO) cells show robust bacterial replication compared to wild-type cells, indicating SAC1's critical role in bacterial growth restriction . Mechanistically, SAC1 controls PI(4)P levels on Salmonella-containing autophagosomes, preventing the recruitment of bacterial effector proteins (such as SteA) that would otherwise impede lysosomal fusion . When SAC1 is absent, there is an aberrant accumulation of PI(4)P on Salmonella-containing autophagosomes, which results in compromised fusion between these autophagosomes and lysosomes, ultimately leading to increased bacterial survival and replication .

What is the difference between 'cis' and 'trans' activity of SAC1, and why is it important?

SAC1 is an obligate 'cis'-acting enzyme, meaning it can only dephosphorylate PI(4)P substrates present in the same membrane where SAC1 resides (ER and Golgi). In contrast, 'trans' activity would involve SAC1 dephosphorylating substrates across different membrane compartments without the need for substrate transport . Experimental evidence strongly supports the 'cis' activity model, as artificial tethering of SAC1 to membrane contact sites results in poor 'trans' activity unless the linker between the transmembrane domain and catalytic domain is extended by approximately 6 nm . This distinction is critically important for experimental design and interpretation of results. For instance, researchers studying phosphoinositide metabolism at membrane contact sites should consider that SAC1 can only act on PI(4)P after it has been transferred to the ER by lipid transfer proteins, rather than directly dephosphorylating PI(4)P in the plasma membrane .

What are the most effective approaches for generating functional recombinant Rat SAC1?

When generating recombinant Rat SAC1, researchers should consider several critical factors to ensure functional protein expression. For bacterial expression systems, the catalytic domain alone (without transmembrane domains) fused to affinity tags (His6 or GST) can be expressed in E. coli strains optimized for eukaryotic protein expression (e.g., BL21(DE3) Rosetta). Expression should be induced at lower temperatures (16-18°C) to enhance proper folding. For mammalian expression systems, full-length SAC1 or the catalytic domain can be expressed using vectors with strong promoters (CMV) in cell lines like HEK293T. The critical residue Cys389 must be preserved for catalytic activity, as mutation to serine (C389S) creates a catalytically dead mutant that serves as an excellent negative control . When purifying recombinant SAC1, include phosphatase inhibitors throughout the purification process to prevent non-specific dephosphorylation, and maintain glycerol (10-15%) in storage buffers to preserve enzyme activity.

How can the phosphatase activity of SAC1 be reliably measured in vitro and in cells?

For in vitro measurement of SAC1 phosphatase activity, a malachite green assay can be employed to detect free phosphate released from PI(4)P substrates. This colorimetric assay uses the formation of a phosphomolybdate-malachite green complex that absorbs at 620-640 nm. Alternatively, radiolabeled substrates (³²P-labeled PI(4)P) can provide more sensitive detection. For cellular assays, genetically encoded biosensors like GFP-P4M (derived from the Legionella SidM protein) can be used to monitor PI(4)P levels in living cells . Higher-avidity tandem repeats (GFP-P4M×2) offer increased sensitivity for detecting residual PI(4)P when SAC1 is overexpressed . When measuring SAC1 activity, researchers should include appropriate controls, such as the catalytically inactive C389S mutant, and time-course measurements to capture the dynamics of phosphoinositide turnover.

How does SAC1 affect bacterial pathogenesis and host defense mechanisms?

SAC1 plays a critical role in restricting intracellular bacterial replication through regulation of autophagy-mediated bacterial clearance (xenophagy). In Salmonella Typhimurium infection models, SAC1's phosphatase activity is essential for proper maturation of Salmonella-containing autophagosomes and their subsequent fusion with lysosomes . The loss of SAC1 creates a more permissive environment for bacterial replication by compromising this fusion process. Mechanistically, SAC1 regulates PI(4)P levels on Salmonella-containing autophagosomes, preventing the recruitment of the bacterial effector protein SteA, which normally interferes with lysosomal fusion . This creates an interesting scenario where bacterial adaptation (Salmonella lacking SteA) can actually be suppressed in SAC1-deficient cells, demonstrating the complex interplay between host defense mechanisms and bacterial virulence strategies .

What is the relationship between environmental toxicants and SAC1 expression?

Various environmental toxicants can significantly alter SAC1 expression, potentially affecting its cellular functions. According to gene-chemical interaction annotations, several compounds modulate Sacm1l expression in rat models. For instance, tetrachlorodibenzodioxin exposure results in decreased expression of SACM1L mRNA . Similarly, 3,4-methylenedioxymethamphetamine (MDMA) has been shown to decrease SAC1 expression . In contrast, bisphenol S exposure increases SACM1L mRNA expression . These differential responses to toxicants suggest that SAC1 may serve as a responsive element in cellular stress pathways. When designing toxicological studies involving phosphoinositide signaling, researchers should consider monitoring SAC1 expression and activity as potential biomarkers of cellular stress responses and altered membrane trafficking.

How can SAC1 be utilized to study membrane contact sites and lipid transfer?

Despite not being enriched at membrane contact sites (MCS), SAC1 plays a critical role in facilitating phosphoinositide-mediated lipid transfer at these sites. Researchers can leverage this function to study MCS dynamics and lipid transfer mechanisms. By creating chimeric constructs with extended linkers between the transmembrane domain and catalytic domain, investigators can artificially induce 'trans' activity of SAC1 at MCS . This approach, combined with fluorescent phosphoinositide sensors, enables real-time visualization of phosphoinositide turnover at contact sites. Additionally, SAC1's function in degrading PI(4)P that has been transferred to the ER by lipid transfer proteins makes it an excellent tool for studying the kinetics of non-vesicular lipid transport . When designing such experiments, researchers should consider the native dimensions of different MCS (ranging from 15-25 nm) and SAC1's limited reach (~7 nm) to properly interpret results .

What experimental systems are optimal for studying SAC1's role in phosphoinositide-mediated signaling?

For cellular studies of SAC1 function, several experimental systems offer distinct advantages. CRISPR-Cas9-generated SACM1L knockout cell lines provide a clean genetic background for rescue experiments with wild-type or mutant SAC1 . For acute manipulation of SAC1 activity, siRNA knockdown approaches can be employed, though they may not achieve complete protein depletion. Chemically-induced dimerization systems using FKBP and FRB domains allow for rapid recruitment of SAC1 to specific membrane compartments, enabling temporal control over phosphoinositide metabolism . For in vivo studies, conditional knockout mouse models are preferred over constitutive knockouts, which may be embryonic lethal due to SAC1's essential functions. When choosing between these systems, researchers should consider the temporal dynamics of their experimental question, as well as the need for spatial control over SAC1 activity.

What are common pitfalls in SAC1 functional studies and how can they be addressed?

When conducting SAC1 functional studies, researchers frequently encounter several challenges. One common issue is the distinction between direct and indirect effects of SAC1 manipulation. Since phosphoinositides regulate numerous cellular processes, phenotypes observed in SAC1-deficient cells may result from broad disruption of phosphoinositide homeostasis rather than specific SAC1 functions. This can be addressed by including phosphoinositide add-back experiments or using phosphoinositide kinase inhibitors as complementary approaches. Another challenge is the potential compensation by other phosphoinositide phosphatases in long-term SAC1 depletion studies. Researchers should consider acute manipulation strategies or simultaneously monitoring expression of other phosphatases. Finally, the transmembrane nature of SAC1 makes biochemical purification challenging. When extracting membrane-bound SAC1, specialized detergents that maintain phosphatase activity should be employed, or alternatively, soluble catalytic domain constructs can be used for in vitro studies.

How can researchers effectively differentiate between direct SAC1 targets and secondary effects?

Differentiating direct SAC1 targets from secondary effects requires multi-faceted experimental approaches. First, utilize catalytically inactive mutants (C389S) as controls in all experiments to distinguish between phosphatase-dependent and scaffolding functions of SAC1 . Second, employ acute manipulation systems (such as chemically-induced dimerization) to observe immediate consequences of SAC1 recruitment before secondary adaptations occur . Third, directly measure PI(4)P levels using specific biosensors in parallel with phenotypic assays to correlate phosphoinositide changes with cellular outcomes. Fourth, complement genetic approaches with in vitro reconstitution systems using purified components to verify direct enzymatic activities. When examining SAC1's role in complex processes like autophagy, researchers should track multiple stages of the process (initiation, elongation, maturation, and degradation) to pinpoint where SAC1 function is most critical.

What emerging technologies could advance our understanding of SAC1 biology?

Several cutting-edge technologies hold promise for deepening our understanding of SAC1 biology. Super-resolution microscopy techniques (STORM, PALM, or STED) can now visualize SAC1 localization with unprecedented precision, potentially revealing previously undetected subpopulations at specialized membrane domains. Proximity labeling methods (BioID or APEX) would allow identification of the SAC1 interactome in its native membrane environment, potentially uncovering novel regulators or effectors. CRISPR-based genetic screens could identify synthetic lethal or suppressor interactions with SAC1 dysfunction, illuminating functional redundancies or compensatory pathways. Cryo-electron microscopy might reveal the structural basis of SAC1's membrane association and substrate recognition, particularly if coupled with nanodiscs to maintain the native membrane environment. Lastly, development of small molecule inhibitors specific to SAC1 would enable rapid and reversible modulation of its activity in diverse experimental settings.

How might SAC1 function be integrated with broader cellular phosphoinositide networks?

SAC1 functions within an intricate network of phosphoinositide-metabolizing enzymes and effector proteins. Future research should explore how SAC1 activity is coordinated with PI4K (PI4-kinase) activity to maintain proper PI(4)P gradients between organelles. The potential role of SAC1 in facilitating phosphoinositide conversion cascades (e.g., PI(4)P to PI(4,5)P₂) at specialized membrane domains warrants further investigation. Additionally, understanding how SAC1 activity responds to cellular stress conditions, metabolic state, or growth factor signaling would illuminate its role in adaptive membrane remodeling. The cross-talk between SAC1-mediated PI(4)P degradation and other phosphoinositide species (PI3P, PI(3,4)P₂, etc.) represents another promising avenue for research. When designing studies to address these questions, researchers should employ systems biology approaches that monitor multiple phosphoinositide species simultaneously, rather than focusing on a single lipid in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.