Recombinant Rat Phospholemman (Fxyd1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat FXYD1 is typically expressed in mammalian cell systems (e.g., HEK293 or insect cells) as a GST fusion protein to facilitate purification. The intracellular region of FXYD1 is cloned, expressed, and purified via GST affinity chromatography. The GST tag is removed by thrombin cleavage, yielding a 37-residue fragment corresponding to the cytoplasmic tail of the protein .

ParameterSpecification
Purity>85% (SDS-PAGE verified)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol addition recommended for stability
Storage-20°C/-80°C (6 months for liquid, 12 months for lyophilized form)
SourceMammalian cell expression system

Phosphorylation and Functional Studies

FXYD1 is a primary substrate for protein kinases A (PKA) and C (PKC) in the heart. Recombinant FXYD1 undergoes phosphorylation at serine (S63, S68) and threonine (T69) residues, as demonstrated by in vitro assays:

  • PKA: Phosphorylates S63 and S68 .

  • PKCα/ε: Phosphorylates S63, S68, and T69, with T69 being a novel PKC-specific site .

Phosphorylation alters its regulatory effects on Na⁺-K⁺-ATPase:

ProteinActivity (μmol/min/mg)EP (nmol/mg)Turnover Rate (min⁻¹)
Na⁺-K⁺-ATPase (α1β1)37.2 ± 2.34.42 ± 0.238163 ± 284
Na⁺-K⁺-ATPase + FXYD127.2 ± 1.04.31 ± 0.156248 ± 115

Phosphorylated FXYD1 reduces Na⁺-K⁺-ATPase activity by ~24% compared to the unphosphorylated form .

Cardiac Myocyte Studies

Recombinant FXYD1 is used to investigate its role in excitation-contraction coupling. In adult rat ventricular myocytes (ARVM), phosphorylation at S68 enhances Na⁺-K⁺-ATPase activity, while inhibiting NCX1 to prevent Na⁺ overload .

Antibody Development

Phosphospecific antibodies (e.g., CP63, CP68, CP69, CP689) are generated using synthetic phosphopeptides derived from FXYD1. These antibodies enable detection of phosphorylation states in immunoblotting and immunoprecipitation assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirement if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Fxyd1; Plm; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-92
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
EAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Uniprot No.

Target Background

Function
Phospholemman (PLM) associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA). NKA is responsible for transporting sodium ions (Na+) out of the cell and potassium ions (K+) into the cell. PLM inhibits NKA activity in its unphosphorylated state, but stimulates activity when phosphorylated. It also reduces glutathionylation of the NKA beta-1 subunit ATP1B1, reversing glutathionylation-mediated inhibition of ATP1B1. PLM contributes to female sexual development by maintaining the excitability of neurons that secrete gonadotropin-releasing hormone.
Gene References Into Functions
  1. Research indicates that Ncx1 (sodium-calcium exchanger 1) serves as a substrate-specifying regulator protein for Pp1c (protein phosphatase 1c). This regulation involves Ser-68-Plm dephosphorylation within cardiomyocytes. The Plm/Ncx1/Pp1c complex is up-regulated in heart failure. PMID: 26668322
  2. PLM exists in two forms: a pump-inhibiting monomer and an unassociated oligomer. PMID: 23532852
  3. Chronic nicotine exposure modifies skeletal muscle Na,K-ATPase activity through interactions with the nicotinic acetylcholine receptor and phospholemman. PMID: 22442718
  4. Investigates the role of protein phosphatase-1 in phospholemman phosphorylation and Na/K-ATPase activity in cardiomyocytes. PMID: 21849407
  5. Palmitoylation of PLM regulates its turnover. Palmitoylated PLM inhibits the sodium pump. PMID: 21868384
  6. Report altered expression of Na(+)-K(+) pump subunits, FXYD1 and NHE1, depending on training status, intensity, and muscle type. PMID: 21325644
  7. Hypertonic activation of this protein in solitary rat hepatocytes in primary culture. PMID: 12606048
  8. Expression in the extraglomerular mesangial cells and juxtaglomerular apparatus arterioles. PMID: 12657562
  9. Myocardial ischemia-induced phosphorylation of phospholemman directly activates cardiac Na/K-ATPase. PMID: 14597563
  10. PLM phosphorylation at Ser68 may be involved in cAMP- and/or protein kinase C-dependent regulation of cardiac contractility. PMID: 15653756
  11. In skeletal muscle, PLM appears to be a protein integral to the Na+-K+-ATPase(NKA) complex, and PLM has the potential to modulate NKA in an isoform-specific and muscle type-dependent manner in aging and after exercise training. PMID: 15961612
  12. These findings suggest that FXYD1 contributes to facilitating the onset of puberty by maintaining GnRH neuronal excitability to incoming transsynaptic stimulatory inputs. PMID: 19187398

Show More

Hide All

Database Links
Protein Families
FXYD family
Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein. Membrane, caveola. Cell membrane, sarcolemma, T-tubule.
Tissue Specificity
In adult brain, highest levels are found in the cerebellum and in the lateral, third and fourth ventricles of the choroid plexus (at protein level). Also detected in cells of a portion of the ependymal lining of the lateral ventricle on its rostral surfac

Q&A

What is the fundamental structure and function of phospholemman (FXYD1)?

Phospholemman (FXYD1) is a member of the FXYD family of tissue-specific regulators of the Na+/K+-ATPase. It is a small, single-spanning membrane protein that associates specifically and stably with various α-β isozymes of Na+/K+-ATPase. In cardiac tissue, FXYD1 serves as the predominant quantitative site of phosphorylation by protein kinase A (PKA) and protein kinase C (PKC) .

The primary function of FXYD1 is regulating the cardiac sodium pump, which is vital for:

  • Maintenance of normal electrical activity

  • Ionic homeostasis

  • Cell volume control

  • Substrate and amino acid transport

  • Setting cellular calcium load

In FXYD1-deficient mice, β-adrenergic and PKC-mediated regulation of the Na+/K+-ATPase is absent, confirming its essential role in pump regulation .

What are the major phosphorylation sites of FXYD1 and their kinase specificity?

FXYD1 contains multiple phosphorylation sites with distinct kinase specificities:

Phosphorylation SiteKinasesPhosphorylation Dynamics
Serine 63 (S63)PKA, PKC~30% phosphorylated in unstimulated cells
Serine 68 (S68)PKA, PKC~30% phosphorylated in unstimulated cells
Threonine 69 (T69)PKC onlyBarely phosphorylated in unstimulated cells

Upon receptor-mediated PKC activation, S63 and S68 show sustained phosphorylation, while T69 phosphorylation is transient . These sites can be studied using in vitro phosphorylation with purified kinases and analyzed through HPLC, mass spectrometry, and Edman sequencing .

How is FXYD1 expressed across different tissues and developmental stages?

FXYD1 expression shows distinct tissue specificity and developmental patterns:

  • Tissue Distribution: Predominantly expressed in cardiac and skeletal muscle, with lower expression in the brain .

  • Brain Region Specificity: Higher expression in cerebellum (CB) and lower in frontal cortex (FC) .

  • Developmental Regulation:

    • In brain: DNA methylation at Fxyd1a promoter increases during development (P1 to P60), correlating with decreased mRNA expression .

    • In heart: DNA methylation at Fxyd1a promoter decreases during development, accompanying increased mRNA expression .

These tissue-specific and developmental patterns suggest a temporal-specific epigenetic program regulating FXYD1 expression.

How does the interaction between FXYD1 and Na+/K+-ATPase affect pump function?

When FXYD1 associates with Na+/K+-ATPase, it modifies the pump's functional properties in several ways:

  • Induces a small decrease in external K+ affinity of α1-β1 and α2-β1 isozymes

  • Causes a nearly 2-fold decrease in internal Na+ affinity

  • Phosphorylation state of FXYD1 alters its regulatory effect on Na+/K+-ATPase

Experimental measurements using whole cell voltage clamping of cultured adult rat ventricular myocytes show that kinase activation increases pump currents:

  • Unstimulated cells: 2.1 ± 0.2 pA/pF

  • PKA activation: 2.9 ± 0.1 pA/pF

  • PKC activation: 3.4 ± 0.2 pA/pF

After kinase activation, phosphorylated FXYD1 can be co-immunoprecipitated with the sodium pump α1-subunit, confirming their physical association .

What methodologies are recommended for studying FXYD1 phosphorylation in cardiac myocytes?

For comprehensive analysis of FXYD1 phosphorylation, the following methodological approaches are recommended:

In vitro Phosphorylation Analysis:

  • Phosphorylate FXYD1 peptides with purified kinases

  • Halt reactions with 0.1% trifluoroacetic acid (TFA)

  • Analyze using HPLC with a reversed-phase C18 column

  • Confirm peptide identity via MALDI mass spectrometry

  • Use Edman sequencing with γ32P-ATP to identify specific phosphorylation sites

Phosphospecific Immunoblotting:

  • Utilize antibodies specific for phosphorylated residues (e.g., CP69 for T69-phosphorylated FXYD1)

  • Include unphosphorylated peptide antigens (10 μg/ml) to neutralize antibodies recognizing unphosphorylated forms

  • For dual phosphorylation detection (e.g., S68 and T69), use additional blocking peptides to ensure specificity

Immunoprecipitation Protocol:

  • Lyse cultured adult rat ventricular myocytes in 1% Triton X-100 buffer with:

    • 20 mM HEPES, pH 7.4

    • 1 mM EDTA

    • Protease inhibitor cocktail

    • Phosphatase inhibitor cocktail 1

    • Additional phosphatase inhibitors (2 mM sodium vanadate, 5 mM sodium fluoride, 2 mM sodium pyrophosphate, 2 mM sodium β-glycerophosphate)

  • Agitate samples (15 min, 4°C) and remove insoluble material by centrifugation

  • Incubate supernatants with anti-Na+/K+-ATPase α1-subunit monoclonal antibodies

  • Harvest immune complexes with protein G Sepharose

  • Wash beads with 0.5 mg/ml C12E8 in PBS with inhibitors

How does threonine 69 phosphorylation differ functionally from other FXYD1 phosphorylation sites?

Threonine 69 (T69) represents a novel phosphorylation site with distinct characteristics:

  • Kinase Specificity: Unlike S63 and S68 which are phosphorylated by both PKA and PKC, T69 is specifically phosphorylated by PKC .

  • Phosphorylation Dynamics: T69 shows transient phosphorylation upon receptor-mediated PKC activation, while S63 and S68 exhibit sustained phosphorylation .

  • Basal Phosphorylation: In unstimulated cardiac myocytes, T69 is barely phosphorylated, whereas S63 and S68 are approximately 30% phosphorylated .

  • Functional Effect: Acute T69 phosphorylation elicits additional stimulation of the sodium pump beyond that induced by S63 and S68 phosphorylation, contributing to the greater increase in pump currents seen with PKC activation (3.4 ± 0.2 pA/pF) compared to PKA activation (2.9 ± 0.1 pA/pF) .

These distinct properties suggest that T69 phosphorylation may serve as a specialized regulatory mechanism activated under specific physiological conditions.

What is the significance of epigenetic regulation in controlling FXYD1 expression?

Epigenetic regulation, particularly DNA methylation, plays a crucial role in controlling FXYD1 expression in a tissue-specific and developmental stage-dependent manner:

Transcript-Specific Methylation Patterns:

  • Fxyd1a promoter shows lower methylation than Fxyd1b across all developmental stages

  • Fxyd1a is less methylated and more expressed than Fxyd1b in both brain and heart tissues

Tissue-Specific Developmental Patterns:

  • Brain: DNA methylation at Fxyd1a promoter significantly increases from P1 to P60 (p-value = 0.011), correlating with decreased expression

  • Heart: DNA methylation at Fxyd1a decreases during development, with corresponding increased expression

  • No significant changes observed at Fxyd1b promoter during brain development

Epiallele Analysis:

Ultra-deep methylation analysis reveals distinct methylation profile distributions between tissues and developmental stages, with different CpG methylation arrangements even among cases with similar average methylation .

This suggests that a temporal-specific epigenetic program involving DNA methylation regulates the transcription of Fxyd1 gene and its isoforms in brain and cardiac tissues, potentially coordinating tissue-specific functions during development.

How does MeCP2 binding influence FXYD1 expression in different brain regions?

MeCP2 (methyl-binding protein) regulates FXYD1 expression in a region-specific manner:

  • Regional Specificity: In MeCP2-null mice, Fxyd1 mRNA levels increase in the frontal cortex (FC) but not in the cerebellum (CB), indicating that MeCP2's repressive function is limited to the FC area .

  • Correlation with DNA Methylation: Lower Fxyd1 transcript levels in FC correlate with higher DNA methylation, suggesting that DNA methylation controls Fxyd1 expression through MeCP2 recruitment .

  • Functional Significance: By interacting with key modulators such as PKA, PKC, myotonic dystrophy protein kinase (DMPK), and never in mitosis (NIMA) kinase, FXYD1 is involved in modulating neural excitability .

  • Pathological Relevance: FXYD1, as a target of MeCP2, plays a crucial role in the pathogenesis of Rett syndrome, a neurodevelopmental disorder .

Understanding this regulatory mechanism could provide insights into region-specific brain functions and pathologies related to FXYD1 dysregulation.

What are the optimal methods for expressing and purifying recombinant rat FXYD1?

Based on published methodologies, the following approach is recommended for recombinant rat FXYD1 expression and purification:

Expression System:

  • Use a fusion protein strategy with Glutathione S-transferase (GST) and the intracellular region of FXYD1

  • Express in standard E. coli systems using established molecular biology techniques

Purification Protocol:

  • Express GST-FXYD1 fusion protein

  • Purify using standard GST affinity purification techniques

  • Remove the GST tag by cleavage with thrombin (GE Healthcare)

  • The resulting recombinant FXYD1 will contain an additional NH2-terminal glycine residue (from the cloning process), followed by a serine equivalent to serine 37 of full-length, processed canine FXYD1

This approach has been successfully used to generate functional recombinant FXYD1 suitable for in vitro phosphorylation studies and other biochemical analyses.

What experimental considerations are important when designing studies with recombinant FXYD1?

When designing experiments using recombinant rat FXYD1, researchers should consider:

Protein Regions:

  • Full-length vs. truncated constructs (e.g., intracellular region only)

  • The sequence of the FXYD1 COOH terminus used in published studies has an additional NH2-terminal glycine residue, followed by a serine equivalent to serine 37 of full-length protein

Phosphorylation Studies:

  • Include appropriate kinases: PKA and PKC for S63/S68, PKC specifically for T69

  • Use phosphospecific antibodies with appropriate blocking peptides to ensure specificity

  • Consider the differential phosphorylation dynamics (sustained for S63/S68, transient for T69)

Functional Assays:

  • Co-expression with Na+/K+-ATPase in suitable systems (e.g., Xenopus oocytes)

  • Electrophysiological measurements of pump currents

  • Assessment of Na+/K+-ATPase affinity for ions

  • Co-immunoprecipitation to verify physical association

Controls:

  • Unphosphorylated FXYD1

  • Phosphorylation-site mutants (S63A, S68A, T69A)

  • Comparison with native FXYD1 from cardiac or skeletal muscle

What are the consequences of altered FXYD1 expression in cardiac pathophysiology?

Alterations in FXYD1 expression levels have significant implications for cardiac function:

Overexpression Effects:

  • Decreased Na+/K+-ATPase current

  • FXYD1 expression increases after myocardial infarction and heart failure

  • Potential contribution to diastolic dysfunction and arrhythmias

Knockout Effects:

  • Fxyd1-knockout mice exhibit:

    • Increased cardiac mass

    • Larger cardiac myocyte cross-sectional area

    • Higher ejection fraction

    • Absence of β-adrenergic and PKC-mediated regulation of Na+/K+-ATPase

These findings indicate that FXYD1 levels must be precisely regulated in cardiac tissue to ensure proper heart functioning. The detailed mechanisms linking FXYD1 dysregulation to specific cardiac pathologies represent an important area for further research.

How does FXYD1 function differ between cardiac and neural tissues?

FXYD1 exhibits tissue-specific functions with distinct regulatory mechanisms:

Cardiac Function:

  • Primary regulator of Na+/K+-ATPase activity

  • Critical for maintaining ionic homeostasis and contractility

  • Mediates β-adrenergic and PKC signaling to the Na+/K+-ATPase

Neural Function:

  • Expression follows a regional pattern (higher in cerebellum, lower in frontal cortex)

  • Subject to MeCP2-mediated repression in the frontal cortex but not cerebellum

  • Involved in modulating neural excitability through interaction with:

    • Protein kinase A (PKA)

    • Protein kinase C (PKC)

    • Myotonic dystrophy protein kinase (DMPK)

    • Never in mitosis (NIMA) kinase

Developmental Regulation:

  • Opposite trends in DNA methylation between brain (increasing) and heart (decreasing) during development

  • Corresponding inverse patterns of gene expression

  • Different epiallele profiles between tissues and across developmental stages

Understanding these tissue-specific differences is crucial for developing targeted approaches to address FXYD1-related pathologies in different organ systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.