Recombinant Rat Phospholipid scramblase 1 (Plscr1)

Shipped with Ice Packs
In Stock

Description

Phagocytosis Modulation

  • PLSCR1 depletion in macrophages increases Fcγ receptor-mediated phagocytosis by 40–60%, while overexpression suppresses it .

  • Localizes to phagocytic cups and phagosomes, suggesting direct involvement in membrane remodeling .

Antiviral Activity

  • PLSCR1 enhances interferon (IFN) signaling by upregulating antiviral ISGs (e.g., ISG15, GBP1) .

  • Blocks SARS-CoV-2 entry by interfering with viral vesicle fusion, dependent on its C-terminal β-barrel domain .

Inflammatory Regulation

  • PLSCR1 inhibits IL-13-driven type 2 inflammation in murine models, with Plscr1⁻/⁻ mice showing exacerbated lung pathology .

Applications in Research

Recombinant rat Plscr1 is utilized to investigate:

  • Lipid scrambling dynamics: Calcium-dependent phosphatidylserine exposure in apoptosis or coagulation .

  • Protein-protein interactions: Binds ECM1 in skin extracellular matrix and RELT receptors in apoptosis pathways .

  • Drug discovery: Screens for PLSCR1-targeted therapies against viral infections (e.g., SARS-CoV-2, influenza) .

Comparative Functional Domains

DomainRoleReference
Palmitoylation motifMembrane anchoring and stability
SH3-binding motifsKinase recruitment (e.g., Src, Lyn)
DNA-binding domainTranscriptional regulation in nucleus

Research Limitations and Gaps

  • Species-specific differences: Rat Plscr1 shares 85% amino acid identity with human PLSCR1, but functional divergences in IFN response remain uncharacterized .

  • Structural dynamics: The β-barrel domain’s role in lipid scrambling vs. antiviral activity requires crystallography studies .

Future Directions

  • Mechanistic studies: Resolve how Plscr1’s nuclear vs. membrane localization is regulated post-translationally.

  • Therapeutic targeting: Optimize PLSCR1-derived peptides for broad-spectrum antiviral applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Plscr1; Phospholipid scramblase 1; PL scramblase 1; Ca(2+-dependent phospholipid scramblase 1; Mg(2+-dependent nuclease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Plscr1
Target Protein Sequence
MEKHGPPEHAAYPIPQADYQGSQGPYPGPQGPYPGPQGPYAGPQGPYPGPQGPYAGPQGPYPGPQPGYPVPPGSYAGGDPSGFPVQHQPAYNHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW
Uniprot No.

Target Background

Function
Phospholipid scramblase 1 (PLSCR1) catalyzes calcium-induced, ATP-independent, rapid bidirectional, and non-specific phospholipid translocation (lipid scrambling or flip-flop) between the inner and outer leaflets of the plasma membrane. This disrupts phospholipid asymmetry, leading to phosphatidylserine externalization on the cell surface. PLSCR1 mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons through its interaction with TRPC5. It also exhibits magnesium-dependent nuclease activity against double-stranded DNA and RNA (but not single-stranded DNA) and can enhance TOP2A-mediated DNA decatenation. Furthermore, PLSCR1 negatively regulates FcR-mediated phagocytosis in differentiated macrophages and may contribute to cytokine-regulated cell proliferation and differentiation.
Gene References Into Functions
  1. Changes in PLSCR1 topography, tyrosine phosphorylation, PS externalization, and exocytosis are distinct phenomena, distinguishable under specific activation conditions. PMID: 18281686
Database Links
Protein Families
Phospholipid scramblase family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor; Cytoplasmic side. Nucleus. Cytoplasm. Cytoplasm, perinuclear region.

Q&A

What is the basic structure and cellular localization of Phospholipid Scramblase 1?

Phospholipid Scramblase 1 (PLSCR1) is classified as a type II transmembrane protein with a distinctive structure consisting of a long cytoplasmic N-terminal domain followed by a single predicted transmembrane helix positioned near the C-terminus . The protein contains a calcium-binding motif that is essential for its scramblase activity, placing PLSCR1 in a novel class of calcium-binding proteins . Regarding cellular localization, PLSCR1 demonstrates a complex distribution pattern that varies with cell type and activation state .

Immunohistochemical and electron microscopy studies have revealed PLSCR1 localization at multiple cellular sites, including:

  • Cell membrane (primary location)

  • Endosomal vesicles (during trafficking)

  • Nuclear compartment (under certain conditions)

  • Extracellular matrix (after secretion)

Interestingly, PLSCR1 undergoes a modification in membrane topology during monocyte-to-macrophage differentiation, suggesting context-dependent structural configurations .

How does PLSCR1 facilitate phospholipid translocation across membranes?

PLSCR1 functions as a calcium-dependent facilitator of phospholipid movement across membrane bilayers. The primary mechanistic function involves the bidirectional and nonspecific translocation (scrambling) of phospholipids between the inner and outer leaflets of the plasma membrane . When activated by calcium binding, PLSCR1 disrupts the asymmetric phospholipid distribution of cell membranes, promoting rapid redistribution of phospholipids across the bilayer .

This process results in the externalization of phosphatidylserine (PS), which normally resides in the inner leaflet of the plasma membrane under resting conditions . The externalized PS subsequently serves as a docking platform for numerous biological processes including:

  • Coagulation cascade initiation

  • Apoptotic cell recognition

  • Macrophage phagocytic signaling

  • Activation of anti-inflammatory responses

The calcium-binding motif within PLSCR1 plays a critical role in this function, as calcium binding induces conformational changes that enable the protein to facilitate phospholipid movement .

What are the validated methods for detecting PLSCR1 expression in cell and tissue samples?

Based on published research protocols, several reliable methodologies have been established for detecting PLSCR1 in experimental systems:

Western Blot Analysis:
Western blot represents a standard approach for PLSCR1 detection with established parameters. For optimal results, researchers should prepare lysates from target cells (such as HeLa or K562 cell lines) and resolve proteins on SDS-PAGE under reducing conditions . PLSCR1 is typically detected at approximately 37 kDa using specific monoclonal antibodies . For example, Mouse Anti-Human PLSCR1 Monoclonal Antibody (Clone #875327) at 1 μg/mL concentration followed by HRP-conjugated secondary antibodies has demonstrated consistent detection specificity .

Immunocytochemistry/Immunofluorescence:
For cellular localization studies, immunofluorescence protocols using fixed cells have proven effective. The established procedure involves:

  • Immersion fixation of cells

  • Incubation with primary antibody (10 μg/mL for 3 hours at room temperature)

  • Detection with fluorophore-conjugated secondary antibodies (such as NorthernLights 557-conjugated Anti-Mouse IgG)

  • Nuclear counterstaining with DAPI

  • Confocal microscopy analysis

This approach has successfully demonstrated cytoplasmic localization of PLSCR1 in various cell lines, including HT-29 human colon adenocarcinoma cells .

Immunohistochemistry with Immunogold Electron Microscopy:
For high-resolution localization studies, immunogold electron microscopy of ultrathin tissue sections provides subcellular detail. This technique has been successfully employed to demonstrate co-localization of PLSCR1 with interaction partners such as ECM1 in the extracellular matrix of human skin samples .

What experimental approaches are recommended for studying PLSCR1 functional activities?

Several methodological approaches have been validated for investigating the diverse functions of PLSCR1:

Phospholipid Scrambling Assays:
To assess the canonical scramblase activity of PLSCR1, researchers can employ fluorescently labeled phospholipid analogs to track membrane translocation events. The addition of calcium ionophores to induce calcium influx can trigger PLSCR1-mediated phospholipid scrambling, which can be quantified through fluorescence-based readouts .

Phagocytosis Assessment Protocols:
For studying PLSCR1's role in phagocytosis, established methods include:

  • Generation of PLSCR1-depleted cell lines using shRNA or CRISPR/Cas9

  • Isolation of bone marrow-derived macrophages from PLSCR1 knockout mice

  • Measurement of FcR-mediated phagocytic activity using fluorescently labeled IgG-opsonized particles

  • Quantification through flow cytometry or microscopy-based analysis

Research has demonstrated that PLSCR1 depletion in THP-1 monocytic cells and in bone marrow-derived macrophages from knockout mice results in increased FcR-mediated phagocytic activity, while PLSCR1 overexpression reduces phagocytosis .

Protein-Protein Interaction Studies:
To investigate PLSCR1's interaction with partner proteins, techniques that have yielded reliable results include:

  • Yeast two-hybrid screening (initially identified ECM1a interaction)

  • Co-immunoprecipitation with specific antibodies

  • GST pull-down assays with tagged protein fragments

  • Immunobeads cross-linked with antibodies for interaction studies in tissue extracts

How does PLSCR1 secretion differ from conventional protein secretion pathways?

PLSCR1 exhibits an unconventional secretion mechanism that contrasts with the classical endoplasmic reticulum/Golgi-dependent pathway utilized by many extracellular proteins. Research has established that PLSCR1 is secreted via a lipid raft-dependent mechanism, representing an alternative protein export pathway .

The distinctive features of PLSCR1 secretion include:

  • Unconventional Secretion Pathway: Unlike proteins that follow the classical ER-Golgi secretory route, PLSCR1 utilizes a non-classical export mechanism dependent on lipid raft microdomains of the plasma membrane .

  • Extracellular Deposition: Following secretion, PLSCR1 becomes deposited in the extracellular matrix, where it can interact with other matrix components such as ECM1a .

  • Dual Functionality: This unconventional secretion allows PLSCR1 to function both intracellularly and extracellularly, expanding its potential roles beyond the plasma membrane .

This unconventional secretion pathway has significant implications for experimental design when studying PLSCR1 in extracellular contexts. Researchers should consider that standard inhibitors of classical secretion (such as Brefeldin A) may not effectively block PLSCR1 export, necessitating alternative approaches such as lipid raft disruption agents to manipulate its secretion .

What are the experimental considerations when investigating PLSCR1's role in immune cell function?

When designing experiments to examine PLSCR1's immunological functions, several methodological considerations should be addressed:

Monocyte/Macrophage Differentiation Models:
Research has demonstrated that PLSCR1 expression increases approximately 3-fold during monocyte-to-macrophage differentiation, accompanied by apparent modifications in membrane topology . Therefore, experimental designs should account for:

  • Differentiation state-specific expression levels

  • Potential topological changes in protein orientation

  • Time-dependent alterations in subcellular localization

Phagocytosis Experimental Design:
When investigating PLSCR1's role in phagocytosis, researchers should consider:

  • Selection of appropriate phagocytic models: PLSCR1 has been specifically implicated in FcR-mediated phagocytosis but not necessarily in other phagocytic pathways .

  • Quantification methods: Flow cytometry, confocal microscopy with 3D reconstruction, and electron microscopy all provide complementary insights into phagocytic activity.

  • Controls for phosphatidylserine exposure: Since constitutive phosphatidylserine exposure occurs in differentiated macrophages independently of PLSCR1, appropriate controls should be included .

  • Dynamic recruitment analysis: PLSCR1 is specifically recruited to both phagocytic cups during particle engulfment and to mature phagosomes, suggesting temporal regulation that should be considered in experimental timeframes .

How can researchers differentiate between PLSCR1's scramblase activity and its other cellular functions?

PLSCR1 exhibits multiple biological functions beyond its canonical phospholipid scrambling activity. To experimentally distinguish between these functions, researchers should consider the following methodological approaches:

Domain-Specific Mutant Analysis:
Generate and utilize PLSCR1 constructs with mutations in specific functional domains:

  • Calcium-binding domain mutants (disrupts scramblase activity)

  • Palmitoylation site mutants (affects membrane association)

  • Nuclear localization signal mutants (prevents nuclear translocation)

  • Protein interaction domain mutants (disrupts specific protein-protein interactions)

These mutants can be expressed in PLSCR1-depleted cells to determine which domains are essential for specific cellular functions .

Subcellular Localization-Based Approaches:
Since PLSCR1 demonstrates distinct localizations (membrane, cytoplasmic, nuclear, extracellular) correlated with different functions, researchers can:

  • Use subcellular fractionation to isolate PLSCR1 from different compartments

  • Employ targeting constructs that restrict PLSCR1 to specific cellular locations

  • Utilize live cell imaging with fluorescently tagged PLSCR1 to monitor real-time localization changes

Functional Readouts:
Establish specific assays for each potential function:

  • Phospholipid scrambling: Annexin V binding for PS externalization

  • Phagocytosis: Quantitative analysis of particle uptake

  • Protein-protein interactions: Co-immunoprecipitation or proximity ligation assays

  • Extracellular matrix association: Immunohistochemistry and electron microscopy

What are common technical challenges when working with recombinant PLSCR1?

Researchers working with recombinant PLSCR1 frequently encounter several technical challenges that require specific troubleshooting approaches:

Protein Solubility Issues:
Recombinant PLSCR1 can exhibit solubility problems due to its transmembrane domain and hydrophobic regions. To address this:

  • Consider expressing truncated versions that exclude the transmembrane domain for solubility studies

  • Use mild detergents for extraction and purification

  • Optimize buffer conditions with ionic strength adjustments and stabilizing agents

Maintaining Native Conformation:
Preserving the functional conformation of PLSCR1 can be challenging during recombinant expression and purification processes. Research suggests:

  • Calcium supplementation in buffers may help maintain native structure

  • Avoid harsh elution conditions that could disrupt calcium binding

  • Consider on-column refolding techniques if inclusion bodies form during bacterial expression

Expression System Selection:
The choice of expression system significantly impacts recombinant PLSCR1 quality. While bacterial systems (E. coli) have been successfully used to produce segments of PLSCR1 (e.g., Met1-Pro84) , full-length protein with post-translational modifications may require:

  • Mammalian expression systems for proper folding and modifications

  • Insect cell systems as a compromise between yield and proper folding

  • Cell-free systems for rapid screening of construct designs

How can researchers resolve contradictory data about PLSCR1 functions?

The literature contains some apparently contradictory findings regarding PLSCR1 functions. To resolve these discrepancies, researchers should consider:

Cell Type-Specific Effects:
PLSCR1 functions appear to be highly context-dependent. For instance, while PLSCR1 was initially characterized primarily as a phospholipid scrambling protein, studies in differentiated macrophages revealed it acts as a negative regulator of phagocytosis . Resolution approaches include:

  • Perform parallel experiments in multiple cell types

  • Clearly define the differentiation state of cells under study

  • Compare results between primary cells and cell lines

Experimental Condition Variations:
Contradictions may arise from differences in experimental conditions, particularly calcium levels, which critically affect PLSCR1 function. Researchers should:

  • Standardize calcium concentrations in experimental buffers

  • Report detailed methodological conditions to enable reproducibility

  • Directly compare different methodologies within the same study

Isoform-Specific Functions:
Consider that different PLSCR isoforms may have specialized functions. When designing experiments:

  • Use isoform-specific antibodies and detection methods

  • Employ specific knockout/knockdown approaches that target individual isoforms

  • Validate recombinant protein sequence integrity before functional studies

What new analytical methods are advancing PLSCR1 research?

Recent technological developments offer new approaches for PLSCR1 investigation:

Advanced Imaging Techniques:
Super-resolution microscopy techniques now enable visualization of PLSCR1 dynamics at previously unattainable resolution:

  • STORM/PALM imaging for nanoscale localization in membrane microdomains

  • Live-cell super-resolution for real-time monitoring of PLSCR1 movement

  • Correlative light and electron microscopy for contextual ultrastructural analysis

Proteomics Approaches:
Mass spectrometry-based methodologies provide comprehensive analysis of:

  • PLSCR1 post-translational modifications under different cellular conditions

  • Dynamic interaction partners through proximity labeling techniques

  • Quantitative changes in PLSCR1 expression across cell states and tissues

Structural Biology:
Recent advances in structural determination methods offer opportunities to resolve PLSCR1 structure at atomic resolution:

  • Cryo-electron microscopy for membrane-embedded PLSCR1

  • NMR studies of PLSCR1 domains and their calcium-binding properties

  • Hydrogen/deuterium exchange mass spectrometry for conformational dynamics

What are promising research areas for investigating PLSCR1's physiological significance?

Based on current literature, several high-potential research directions for PLSCR1 include:

Immunological Regulation:
PLSCR1's role in immune cell function presents several promising research avenues:

  • Investigation of PLSCR1 in innate type 2 inflammatory responses

  • Further characterization of its negative regulatory role in FcR-mediated phagocytosis

  • Exploration of potential functions in additional immune cell types beyond macrophages

Extracellular Matrix Interactions:
The discovery of PLSCR1 secretion and ECM1 interaction opens new research directions:

  • Comprehensive mapping of PLSCR1's extracellular interactome

  • Functional significance of PLSCR1-ECM1 interaction in tissue homeostasis

  • Potential role in dermal-epidermal junction organization and skin barrier function

Disease Associations:
Several lines of evidence suggest PLSCR1 involvement in pathological conditions:

  • Potential contributions to coagulation disorders through phosphatidylserine externalization

  • Role in cancer cell biology, as suggested by studies in HeLa and K562 cancer cell lines

  • Possible involvement in inflammatory skin conditions given its interaction with ECM1, which is implicated in lipoid proteinosis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.