Recombinant Rat Plasminogen receptor (KT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life is 6 months at -20°C/-80°C for liquid formulations and 12 months at -20°C/-80°C for lyophilized formulations.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Plgrkt; Plasminogen receptor; KT; Plg-R(KT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Plgrkt
Target Protein Sequence
MGFIFSKSMNENMKNQQEFMVMHARLQLERQLIMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLAAGAIKRKKPAFLIPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKFFSDK
Uniprot No.

Target Background

Function

The plasminogen receptor regulates urokinase plasminogen activator (uPA)-dependent and stimulates tissue-type plasminogen activator (tPA)-dependent cell surface plasminogen activation. It is implicated in a local catecholaminergic cell plasminogen activation system, influencing neuroendocrine prohormone processing. Furthermore, it plays a role in inflammatory response regulation, modulating monocyte chemotactic migration and the activation of matrix metalloproteinases (MMPs), such as MMP-2 and MMP-9.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in adrenal medulla (pheochromocytoma).

Q&A

What is Plasminogen Receptor (KT) and what are its structural characteristics?

Plasminogen Receptor (KT) is a unique plasminogen-binding protein with distinctive characteristics that separate it from other plasminogen receptors. It is a transmembrane protein that includes 147 amino acids with a molecular mass of 17,261 Da . Unlike other plasminogen receptors, Plg-RKT is synthesized with a C-terminal basic residue (lysine) that is exposed on the cell surface in an orientation specifically designed to promote cell-dependent plasminogen activation . This receptor is highly conserved across species, with human and mouse variants showing 94% similarity . Sequence analysis of 20 mammalian orthologs reveals high identity with no gaps in the sequence, indicating evolutionary importance .

Where is Plasminogen Receptor (KT) expressed in tissues and cells?

Plg-RKT demonstrates a specific expression pattern across various tissues. The receptor is prominently expressed in:

  • Adrenal medullary chromaffin cells in both human and murine tissues

  • Bovine adrenomedullary chromaffin cells

  • Human pheochromocytoma tissue

  • PC12 pheochromocytoma cells

  • Murine hippocampus

  • Proinflammatory monocytes and macrophages

Immunohistochemical studies using anti-Plg-RKT monoclonal antibodies have confirmed this expression pattern, with specific staining observed in adrenal medullary cells that could be blocked by preincubation with the immunizing peptide CEQSKFFSDK (corresponding to the nine C-terminal amino acids of rat Plg-RKT with an amino-terminal cysteine added for coupling) .

What are the primary functions of Plasminogen Receptor (KT) in cellular systems?

Plg-RKT serves multiple critical functions in cellular systems:

  • Plasminogen activation: It binds plasminogen and promotes its activation to plasmin by plasminogen activators on cell surfaces .

  • Colocalization with other components: Plg-RKT colocalizes with urokinase-type plasminogen activator receptor (uPAR) and can bind tissue plasminogen activator (t-PA), bringing the substrate (plasminogen) and its activators in close proximity on the cell surface to enhance plasminogen activation .

  • Cell migration regulation: It plays a significant role in both chemotaxis (directional migration) and chemokinesis (non-directional motility) of cells in response to stimuli such as MCP-1 .

  • Inflammation mediation: The receptor is involved in macrophage recruitment during inflammatory responses .

  • Neurotransmitter release modulation: In catecholaminergic cells, Plg-RKT stimulates plasminogen activation and regulates catecholamine release .

How is Plasminogen Receptor (KT) involved in the plasminogen activation system?

Plg-RKT serves as a crucial focal point for regulating cell surface-dependent plasminogen activation. It functions by:

  • Binding plasminogen via its exposed C-terminal lysine residue, positioning plasminogen in an orientation that facilitates its activation .

  • Interacting with plasminogen activators such as tissue plasminogen activator (t-PA) .

  • Colocalizing with urokinase-type plasminogen activator receptor (uPAR), creating an efficient activation complex. The extent of colocalization of Plg-RKT with uPAR was measured at 73 ± 3% .

  • Promoting cell-dependent plasminogen activation. Studies have shown that monoclonal antibodies against Plg-RKT (such as anti-Plg-RKT mAb35B10) substantially suppress cell-dependent plasminogen activation by 46% and cell differentiation-dependent plasminogen activation by 58% .

This system of interactions creates a highly efficient local plasminogen activation environment on the cell surface.

What methodologies are recommended for studying Plg-RKT cellular localization and trafficking?

For researching the cellular localization and trafficking of Plg-RKT, several complementary methodologies have proven effective:

  • Fusion protein expression: Creating Plg-RKT fused in-frame to green fluorescent protein (GFP) results in targeting of the GFP signal to the cell membrane, allowing for live-cell visualization of receptor localization .

  • Phase partitioning: This technique separates integral membrane proteins from peripheral membrane and cytosolic proteins, confirming Plg-RKT's status as an integral plasma membrane protein .

  • Co-immunoprecipitation: Co-immunoprecipitation with urokinase-type plasminogen activator receptor (uPAR) helps establish the spatial relationship between Plg-RKT and other components of the plasminogen activation system .

  • FACS analysis with C-terminus-directed antibodies: Flow cytometry using antibodies directed against the C-terminus of Plg-RKT confirms the orientation of the receptor on the cell surface, with the C-terminal lysine exposed extracellularly .

  • Immunohistochemistry: Using monoclonal antibodies against Plg-RKT with appropriate controls (such as preincubation with the immunizing peptide) provides tissue-specific localization information .

For trafficking studies, additional approaches may include pulse-chase experiments with radiolabeled amino acids and subcellular fractionation to track the movement of newly synthesized Plg-RKT from the endoplasmic reticulum to the plasma membrane.

How can researchers effectively measure Plg-RKT-dependent plasminogen activation in experimental models?

Measuring Plg-RKT-dependent plasminogen activation requires specific techniques that distinguish its contribution from other plasminogen receptors:

  • Cell-based plasminogen activation assays:

    • Add Glu-plasminogen (2.7 μM) and t-PA (20 nM) to cells in culture

    • Monitor conversion to plasmin using chromogenic or fluorogenic substrates

    • Compare activation rates in the presence and absence of cells to determine cell-dependent activation

  • Antibody blocking experiments:

    • Use specific monoclonal antibodies against Plg-RKT (such as anti-Plg-RKT mAb35B10) to block the receptor

    • Compare plasminogen activation before and after antibody treatment

    • Control experiments should include isotype-matched control antibodies

  • Overexpression studies:

    • Generate stably transfected cell lines overexpressing Plg-RKT

    • Compare plasminogen activation in overexpressing cells versus control-transfected cells

    • Studies have shown that cells stably overexpressing Plg-RKT exhibit substantial enhancement of plasminogen activation

  • siRNA knockdown approach:

    • Transfect cells with siRNA targeting Plg-RKT

    • Verify knockdown efficiency by Western blotting

    • Measure reduction in plasminogen activation capacity

What are the technical challenges in producing and purifying recombinant Rat Plasminogen Receptor (KT)?

Production and purification of recombinant Plg-RKT present several technical challenges that researchers should consider:

  • Expression system selection: As an integral membrane protein, Plg-RKT requires careful consideration of expression systems. Mammalian cell systems such as Expi293F cells have been successfully used for expressing similar proteins . Researchers should avoid prokaryotic systems that may not properly process the C-terminal lysine essential for function.

  • Maintaining C-terminal integrity: The C-terminal lysine is critical for plasminogen binding. Expression strategies must ensure this lysine remains intact and is not cleaved by cellular carboxypeptidases. Consider adding protease inhibitors during purification.

  • Solubilization challenges: As an integral membrane protein, solubilization requires careful detergent selection. A detergent screen is recommended, testing mild non-ionic detergents (DDM, LMNG) and zwitterionic detergents (CHAPS, FC-12).

  • Purification strategy: A multi-step approach is typically needed:

    • Affinity chromatography using tagged constructs (His-tag or FLAG-tag)

    • Ion exchange chromatography exploiting the protein's charge properties

    • Size exclusion chromatography for final polishing

  • Functional validation: Verify that the purified protein retains plasminogen binding capacity through:

    • Ligand blotting with plasminogen

    • Surface plasmon resonance to determine binding kinetics

    • Cell-based plasminogen activation assays with the purified protein

What are the most effective in vivo models for studying Plg-RKT function in inflammation and wound healing?

Several in vivo models have proven valuable for investigating Plg-RKT function in inflammation and wound healing:

  • Burn wound model in knockout mice:

    • Studies using global deletion of Plg-RKT in mice subjected to standard burn wounds have been effective in evaluating its role in wound healing

    • This model allows assessment of wound closure rates, inflammatory cell recruitment, and extracellular matrix remodeling

  • Macrophage recruitment models:

    • Thioglycollate-induced peritonitis model to assess macrophage recruitment

    • This can be combined with bone marrow transplantation to distinguish between the roles of Plg-RKT in resident versus infiltrating cells

  • Matrigel invasion assays:

    • While primarily an ex vivo model, Matrigel invasion assays using monocytoid cells responding to MCP-1 have shown that Plg-RKT plays a major role in matrix invasion

    • Treatment with anti-Plg-RKT monoclonal antibodies decreased migration of U937 cells and human peripheral blood monocytes through Matrigel by 54% and 48%, respectively

  • Cardiovascular models:

    • Thrombosis models to assess fibrinolytic activity

    • Ischemia-reperfusion injury models to evaluate inflammatory responses

These models should be combined with appropriate controls, including isotype control antibodies for blocking experiments and careful consideration of strain background effects in genetic models.

How does Plg-RKT interact with other components of the plasminogen activation system?

Plg-RKT exhibits specific interactions with multiple components of the plasminogen activation system, creating a functional complex on the cell surface:

  • Interaction with plasminogen:

    • Plg-RKT binds plasminogen through its exposed C-terminal lysine

    • This binding can be inhibited by lysine analogs such as ε-aminocaproic acid (EACA) or by monoclonal antibodies against the C-terminal domain of Plg-RKT

  • Colocalization with uPAR:

    • Confocal microscopy studies have revealed that Plg-RKT markedly colocalizes with uPAR on cell surfaces

    • The extent of colocalization was quantified at 73 ± 3% in M-CSF-differentiated monocyte progenitor Hoxa9-ER4 cells

    • This colocalization brings plasminogen and its activator (uPA) into close proximity

  • Binding to t-PA:

    • Plg-RKT has been shown to bind tissue plasminogen activator (t-PA)

    • This creates a trimolecular complex (Plg-RKT, plasminogen, and t-PA) that efficiently promotes plasminogen activation

  • Functional interaction with PAI-1:

    • While direct binding has not been extensively characterized, the interaction of the plasminogen activation complex with plasminogen activator inhibitor-1 (PAI-1) is functionally important

    • Modified t-PAs with mutations conferring resistance to PAI-1 (such as mt-PA) show enhanced activity in the presence of Plg-RKT

These interactions create an integrated system that spatially organizes the key components of plasminogen activation, enhancing efficiency and providing regulatory control points.

What are the functional differences between Plg-RKT and other plasminogen receptors?

Plg-RKT possesses several distinguishing characteristics that set it apart from other plasminogen receptors:

  • Structural uniqueness:

    • Unlike many other plasminogen receptors which are cytosolic proteins that relocate to the cell surface (e.g., α-enolase, annexin A2), Plg-RKT is a true integral membrane protein

    • It is synthesized with its C-terminal lysine, whereas other receptors may require proteolytic processing to expose C-terminal lysines

  • Regulation of chemotactic migration:

    • Plg-RKT uniquely regulates chemotactic migration in the absence of extracellular matrix

    • Other plasminogen receptors do not regulate this function

    • Chemotactic migration of U937 cells and human peripheral blood monocytes was reduced by 64% and 39%, respectively, by treatment with anti-Plg-RKT monoclonal antibody

  • Regulation of chemokinesis:

    • Plg-RKT is involved in nondirectional cell motility (chemokinesis) in response to stimuli like MCP-1

    • In checkerboard analysis, anti-Plg-RKT antibody 7H1 suppressed chemokinesis almost to background levels

  • Role in neurotransmitter release:

    • In catecholaminergic cells, Plg-RKT modulates neurotransmitter release

    • Cells overexpressing Plg-RKT showed markedly decreased nicotine-evoked [³H]norepinephrine release (by 51 ± 2%, p < 0.001) compared to control cells

    • This neuronal function appears to be specific to Plg-RKT among plasminogen receptors

  • Efficiency in promoting plasminogen activation:

    • The specific orientation and membrane integration of Plg-RKT allow it to promote plasminogen activation more efficiently than many other plasminogen receptors

    • It forms functional complexes with both t-PA and uPAR, creating an activation hub

These functional differences make Plg-RKT a unique and important target for research into plasminogen-dependent processes in inflammation, wound healing, neuronal function, and other biological processes.

What methodological approaches are most effective for studying Plg-RKT in neurological systems?

Studying Plg-RKT in neurological systems requires specialized approaches that account for the complex cellular environment and its role in neurotransmitter regulation:

  • Neurotransmitter release assays:

    • Preload neuronal cells with radiolabeled neurotransmitters (e.g., [³H]norepinephrine)

    • Stimulate release with appropriate agonists (e.g., nicotine for catecholaminergic cells)

    • Measure released radioactivity in the presence or absence of Plg-RKT manipulation

    • In PC12 cells, nicotine-evoked [³H]norepinephrine release from cells overexpressing Plg-RKT was decreased by 51 ± 2% compared to control cells

  • Primary neuronal cultures:

    • Isolate and culture primary neurons from specific brain regions (hippocampus, cerebral cortex, cerebellum)

    • Evaluate Plg-RKT expression using immunocytochemistry and Western blotting

    • Manipulate expression using viral vectors for overexpression or siRNA knockdown

  • Brain slice electrophysiology:

    • Prepare acute brain slices from regions expressing Plg-RKT (e.g., hippocampus)

    • Apply recombinant Plg-RKT, blocking antibodies, or plasminogen with/without activators

    • Record synaptic transmission and plasticity changes using patch-clamp techniques

  • Neurite outgrowth assays:

    • Assess the role of Plg-RKT in plasminogen-dependent neurite outgrowth

    • Measure neurite length and branching in the presence of Plg-RKT manipulations

    • Combine with plasminogen and plasminogen activators to assess the complete pathway

  • In vivo approaches:

    • Conditional knockout models using neuron-specific Cre drivers (e.g., CamKIIα-Cre for forebrain neurons)

    • Stereotaxic injection of viral vectors expressing Plg-RKT or shRNA

    • Behavioral assays to assess functional outcomes of Plg-RKT manipulation

These methodologies can help elucidate the role of Plg-RKT in neuronal plasminogen activation and its effects on neurotransmitter release, synaptic function, and neuronal plasticity.

How can researchers distinguish between the effects of Plg-RKT and other plasminogen receptors in experimental systems?

Distinguishing between Plg-RKT and other plasminogen receptors requires specific experimental strategies that exploit their unique characteristics:

  • Highly specific antibodies:

    • Use monoclonal antibodies directed against the unique C-terminal domain of Plg-RKT

    • Validate specificity by demonstrating reduced binding after preincubation with the immunizing peptide (CEQSKFFSDK)

    • Use these antibodies in blocking experiments to isolate Plg-RKT-dependent effects

  • Selective gene silencing:

    • Design siRNA or shRNA targeting unique regions of Plg-RKT mRNA

    • Perform parallel experiments with siRNAs targeting other plasminogen receptors

    • Compare the phenotypic effects to identify receptor-specific functions

  • Membrane fractionation:

    • Exploit the integral membrane nature of Plg-RKT

    • Use phase partitioning techniques to separate integral membrane proteins from peripheral membrane proteins

    • Analyze plasminogen binding and activation in different fractions

  • Function-specific assays:

    • Focus on processes uniquely regulated by Plg-RKT, such as chemotactic migration in the absence of extracellular matrix

    • Studies have shown that other plasminogen receptors do not regulate this function

    • Similarly, examine chemokinesis, which is strongly regulated by Plg-RKT

  • Cellular localization:

    • Use confocal microscopy to examine colocalization with known markers

    • Plg-RKT strongly colocalizes with uPAR (73 ± 3% colocalization)

    • Compare this pattern with the distribution of other plasminogen receptors

  • Recombinant protein competition studies:

    • Express the C-terminal domain of Plg-RKT and use it as a competitive inhibitor

    • Compare with similar domains from other plasminogen receptors

    • Measure the differential effects on plasminogen binding and activation

These approaches allow researchers to delineate the specific contributions of Plg-RKT amid the complex network of plasminogen receptors that may be simultaneously active in cellular systems.

What are the most informative genetic models for studying Plg-RKT function?

Several genetic models provide valuable insights into Plg-RKT function across different biological contexts:

  • Global knockout models:

    • Complete deletion of Plg-RKT in mice has been used to study its role in wound healing using standard burn wound models

    • This approach reveals system-wide requirements for Plg-RKT in development and homeostasis

  • Conditional knockout models:

    • Tissue-specific deletion using the Cre-loxP system

    • Particularly valuable for studying neuronal functions without confounding developmental effects

    • Examples include macrophage-specific deletion (using LysM-Cre) to study inflammation

    • Neuron-specific deletion (using Syn1-Cre or CamKIIα-Cre) for studying neuronal functions

  • Inducible knockout systems:

    • Temporal control of Plg-RKT deletion using tamoxifen-inducible Cre (CreERT2)

    • Allows distinction between developmental and acute functions

    • Provides a tool to study Plg-RKT in adult tissues or specific disease states

  • Knock-in reporter models:

    • Replace endogenous Plg-RKT with a fluorescent fusion protein

    • Enables live tracking of expression patterns and protein localization

    • Useful for developmental studies and cellular trafficking research

  • Point mutation models:

    • Specific mutations of the C-terminal lysine to another amino acid

    • Tests the functional importance of the C-terminal lysine for plasminogen binding

    • Can help distinguish plasminogen-dependent from plasminogen-independent functions

  • Humanized mouse models:

    • Replace mouse Plg-RKT with the human ortholog

    • Particularly valuable for preclinical testing of therapeutics targeting human Plg-RKT

    • Allows for testing human-specific antibodies or inhibitors

These genetic models, especially when used in combination, provide comprehensive insights into Plg-RKT function across different physiological and pathological contexts.

What are the critical quality control parameters for recombinant Plg-RKT production?

Ensuring the quality of recombinant Plg-RKT requires rigorous assessment of several critical parameters:

  • Integrity of C-terminal lysine:

    • The C-terminal lysine is essential for plasminogen binding

    • Verify using mass spectrometry analysis

    • Functional assessment through plasminogen binding assays

    • Test susceptibility to carboxypeptidase B treatment, which should abolish plasminogen binding

  • Protein purity:

    • ≥90% purity by SDS-PAGE with Coomassie staining

    • Absence of proteolytic fragments

    • Free from endotoxin contamination (<0.1 EU/mg protein)

    • Single peak by analytical size exclusion chromatography

  • Proper folding and conformation:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability using differential scanning fluorimetry

    • Resistance to limited proteolysis as a measure of compact folding

  • Functional activity:

    • Plasminogen binding assay with Kd determination

    • Ability to enhance plasminogen activation by t-PA or uPA

    • Competitive inhibition by the C-terminal peptide CEQSKFFSDK or by ε-aminocaproic acid (EACA)

  • Membrane incorporation capacity:

    • For studies requiring membrane integration, verify incorporation into liposomes or cell membranes

    • Correct orientation with C-terminus exposed on the outer surface

    • Resistance to extraction by high salt but extraction by detergents

  • Stability parameters:

    • Shelf-life determination at different storage conditions

    • Freeze-thaw stability (typically stable for ≤3 cycles)

    • Temperature sensitivity during handling

  • Batch-to-batch consistency:

    • Reproducible plasminogen binding capacity across production batches

    • Consistent enhancement of plasminogen activation

    • Standardized specific activity measurements

These quality control parameters ensure that recombinant Plg-RKT preparations maintain the critical functional characteristics needed for reliable experimental results.

How might Plg-RKT be involved in cardiovascular disease pathogenesis?

Plg-RKT likely plays several significant roles in cardiovascular disease pathogenesis through its involvement in the plasminogen activation system:

  • Thrombolysis regulation:

    • Cardiovascular diseases account for 17.3 million deaths per year globally, projected to grow to more than 23.6 million by 2030

    • Plg-RKT enhances plasminogen activation to plasmin, which dissolves fibrin, the insoluble matrix of clots

    • By regulating local plasminogen activation, Plg-RKT may influence thrombus resolution and vascular patency

  • Inflammatory cell recruitment:

    • Plg-RKT is preferentially expressed on proinflammatory monocytes and macrophages

    • It regulates macrophage invasion and migration, critical processes in atherosclerotic plaque development

    • Plg-RKT-dependent plasmin formation may promote cytokine release from macrophages, further driving inflammation

  • Vascular remodeling:

    • Plasmin generated through Plg-RKT-dependent mechanisms activates matrix metalloproteinases

    • This activation leads to extracellular matrix degradation and vascular wall remodeling

    • Such remodeling is critical in atherosclerosis progression, aneurysm formation, and post-infarction healing

  • Interaction with fibrinolytic therapeutics:

    • Tissue plasminogen activator (t-PA) derivatives like Alteplase are used as thrombolytics

    • A novel mutated chimeric t-PA (mt-PA) with enhanced properties has been developed

    • Plg-RKT likely interacts with these therapeutic agents, potentially influencing their efficacy

  • Tissue repair after ischemic injury:

    • Plg-RKT's role in wound healing suggests it may participate in myocardial repair after infarction

    • The balance between beneficial repair and adverse remodeling may be influenced by Plg-RKT function

The multiple roles of Plg-RKT in cardiovascular pathophysiology make it a potential target for therapeutic intervention, particularly in acute thrombotic events and chronic inflammatory vascular diseases.

What are the potential applications of recombinant Plg-RKT in research on neurodegenerative diseases?

Recombinant Plg-RKT holds promising research applications in neurodegenerative disease investigations:

  • Regulation of neuroinflammation:

    • Neurodegenerative diseases feature chronic inflammation involving microglia and infiltrating macrophages

    • Plg-RKT is preferentially expressed on proinflammatory macrophages

    • Recombinant Plg-RKT can be used to study how plasminogen activation influences microglial activation and neuroinflammatory processes

  • Synaptic plasticity modulation:

    • Plasmin-dependent processes influence synaptic remodeling

    • Plg-RKT regulates neurotransmitter release in catecholaminergic cells

    • Recombinant Plg-RKT can be applied to neuronal cultures or brain slices to examine effects on synaptic transmission and plasticity, processes disrupted in diseases like Alzheimer's

  • Amyloid clearance studies:

    • Plasmin degrades amyloid-β peptides

    • Recombinant Plg-RKT could be used to enhance local plasminogen activation and study effects on amyloid clearance

    • This approach might provide insights into potential therapeutic strategies for Alzheimer's disease

  • Blood-brain barrier permeability:

    • Plasmin influences blood-brain barrier integrity

    • Recombinant Plg-RKT could be used to study how regulated plasminogen activation affects barrier function

    • This has implications for neuroinflammation and drug delivery in neurodegenerative diseases

  • Protein aggregation and clearance:

    • Many neurodegenerative diseases feature protein aggregates (tau, α-synuclein, TDP-43)

    • Plasmin might contribute to aggregate clearance

    • Recombinant Plg-RKT can be used in models to test whether enhanced plasminogen activation affects aggregate burden

  • Precision targeting in animal models:

    • Conjugating recombinant Plg-RKT to nanoparticles could allow targeted delivery to specific brain regions

    • This approach could help develop region-specific models of altered plasminogen activation in the CNS

    • Such models would be valuable for studying regional vulnerability in diseases like Parkinson's or Alzheimer's

These applications highlight how recombinant Plg-RKT can serve as both a research tool and a potential therapeutic development platform for neurodegenerative disease research.

How can researchers resolve contradictory findings in Plg-RKT research?

Resolving contradictory findings in Plg-RKT research requires systematic approaches to identify sources of variation and reconcile discrepancies:

  • Standardize experimental systems:

    • Establish consistent cell lines and primary cell isolation protocols

    • Define standardized expression levels for recombinant systems

    • Use common reagents, particularly antibodies and recombinant proteins

    • Develop reference standards for functional assays

  • Comprehensive characterization of tools:

    • Validate antibody specificity using knockout controls and peptide competition

    • Sequence verification of all expression constructs

    • Quality control testing of recombinant proteins for integrity of the C-terminal lysine

    • Cross-laboratory validation of key reagents

  • Context-dependent functions:

    • Systematically test Plg-RKT function across different cell types

    • Examine effects of cellular activation states, particularly for immune cells

    • Consider the influence of the extracellular matrix composition

    • Evaluate the impact of other components of the plasminogen activation system

  • Genetic background considerations:

    • For in vivo studies, use consistent genetic backgrounds or backcross sufficiently

    • Consider potential compensatory mechanisms in knockout models

    • Use acute knockdown approaches alongside long-term genetic models

    • Implement tissue-specific conditional knockouts to minimize systemic effects

  • Methodological triangulation:

    • Apply multiple independent techniques to address the same question

    • Combine genetic, pharmacological, and antibody-based approaches

    • Use both gain-of-function and loss-of-function strategies

    • Develop quantitative readouts rather than relying on qualitative assessments

  • Collaborative research initiatives:

    • Establish multi-laboratory studies with standardized protocols

    • Create shared repositories of validated reagents and models

    • Implement blinded analysis of key experiments

    • Publish comprehensive methods including negative and contradictory results

By implementing these approaches, researchers can systematically address contradictions in the field and develop a more coherent understanding of Plg-RKT biology across different experimental contexts.

What are the latest advances in understanding how Plg-RKT functions in tissue-specific contexts?

Recent advances have expanded our understanding of Plg-RKT's tissue-specific functions:

  • Role in wound healing:

    • Studies using mice with global deletion of Plg-RKT have revealed its importance in burn wound healing

    • The receptor appears to coordinate macrophage recruitment and function during tissue repair

    • This function may be particularly relevant in tissues with high regenerative capacity

  • Neurotransmitter regulation:

    • In catecholaminergic cells, Plg-RKT functions as a critical regulator of neurotransmitter release

    • Overexpression studies in PC12 cells have shown that Plg-RKT decreases nicotine-evoked norepinephrine release by 51 ± 2%

    • This suggests a feedback regulatory role in neuronal signaling

  • Adrenal medullary function:

    • Plg-RKT is prominently expressed in adrenal medullary chromaffin cells across species

    • This conserved expression pattern suggests an evolutionarily important role in catecholamine regulation

    • The receptor may coordinate stress responses through regulated catecholamine release

  • Hippocampal expression:

    • High expression of Plg-RKT in the hippocampus suggests roles in learning and memory

    • The plasminogen activation system influences synaptic plasticity

    • Plg-RKT may provide spatial regulation of this system in hippocampal circuits

  • Inflammatory cell specificity:

    • Plg-RKT is preferentially expressed on proinflammatory monocytes and macrophages

    • This selective expression suggests it may be a marker and functional regulator of specific macrophage polarization states

    • The receptor potentially coordinates the pro-inflammatory response through regulated plasminogen activation

  • Diverse organ involvement:

    • The Plg-RKT transcript has a broad distribution across tissues

    • This suggests that Plg-RKT may serve tissue-specific functions in multiple organ systems

    • Recent work is beginning to elucidate these diverse roles beyond the initially characterized immune and neural functions

These advances highlight the diverse tissue-specific functions of Plg-RKT and emphasize the importance of studying this receptor across multiple physiological contexts and organ systems.

How do post-translational modifications affect Plg-RKT function?

Post-translational modifications (PTMs) can significantly influence Plg-RKT function, though this area remains relatively unexplored:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.