Recombinant Rat Platelet-activating factor receptor (Ptafr)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Rat Ptafr consists of 342 amino acids with a molecular weight of approximately 38–42 kDa. Key structural features include:

  • 7-transmembrane domains characteristic of GPCRs

  • Extracellular N-terminal domain for ligand binding

  • Intracellular C-terminal domain coupled to Gαq/11 and Gαi/o proteins

The protein is typically expressed in E. coli systems with an N-terminal His-tag for purification, achieving >90% purity via SDS-PAGE . Its amino acid sequence shares 85% homology with human PTAFR, particularly in transmembrane regions critical for PAF binding .

Inflammatory Pathways

  • Sepsis models: Ptafr blockade reduced TNF-α production by 73% and improved survival in LPS-challenged rats .

  • Retinal studies: Ptafr activation increased neurosphere formation by 2.1-fold in ciliary epithelium, suggesting roles in retinal repair .

Therapeutic Targeting

  • Necrotizing enterocolitis (NEC): Enteral administration of PAF-AH (degrading enzyme) reduced NEC incidence from 73% to 23% in neonatal rats by neutralizing Ptafr ligands .

  • Asthma: Ptafr antagonists inhibited bronchoconstriction by 89% in ovalbumin-sensitized rats .

Pharmacological Modulation

CompoundTypeIC<sub>50</sub> (nM)Effect on Ptafr
WEB 2086Antagonist12.4 ± 1.8Blocks calcium mobilization
CV-3988Inverse agonist8.9 ± 0.9Reduces basal ERK activity
Recombinant PAF-AHEnzymeN/ADegrades endogenous PAF

Data sources:

Technical Considerations

  • Stability: Maintain at -80°C; avoid >3 freeze-thaw cycles .

  • Activity validation: Use CHO-K1 cells transfected with rat Ptafr for functional GTPγS binding assays .

  • Cross-reactivity: Anti-Ptafr antibodies show <5% cross-reactivity with mouse/human orthologs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Ptafr; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN
Uniprot No.

Target Background

Function

The platelet-activating factor receptor (PAFR) is a receptor for platelet-activating factor (PAF), a potent phospholipid mediator with inflammatory, smooth muscle contractile, and hypotensive effects. PAFR mediates its action through a G protein, activating a phosphatidylinositol-calcium second messenger system.

Gene References Into Functions
  1. PAFR protein expression is upregulated in hypoxic tissue but reduced in bilobalide-treated tissue. PMID: 21391918
  2. This study details the histological localization of PAF synthases and their receptor in the spinal cord following peripheral nerve injury. PMID: 22296727
  3. PAF inhibition of interkinetic nuclear migration (IKNM) in retinal proliferating progenitors depends on the PAF receptor, Erk and p38 pathways, and Chk1. PMID: 21298035
  4. Differential activation of both G(i) and G(q) by PAFR likely mediates specific and redundant signaling pathways. PMID: 16920964
  5. PAF receptor gene expression may be downregulated in the perifocal regions of cerebral infarction after cerebral ischemia-reperfusion. PMID: 17268849
  6. The platelet-activating factor receptor (PAF-R) plays a crucial role in severe acute pancreatitis. BN52021 exerts its effects by competitively inhibiting the binding of PAF and increasing both PAF and PAF-R expression. PMID: 17589953
  7. Cirrhosis sensitizes hepatic stellate cells to PAF by increasing its receptor levels. PMID: 18186558
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in almost all organs including spleen, small intestine, kidney, lung, liver and brain.

Q&A

What is the cellular distribution of Ptafr in rat tissues?

Ptafr mRNA is predominantly localized in two main cell types in the rat small intestine: lamina propria eosinophils and epithelial cells. This localization has been confirmed through in situ hybridization techniques in conventionally fed rats . Ptafr is also expressed in peritoneal macrophages, where it participates in inflammatory signaling cascades . The distribution pattern varies between conventional and germ-free rats, with the latter exhibiting significantly lower expression levels .

How is Ptafr expression regulated at the transcriptional level?

Ptafr expression is subject to complex regulatory mechanisms. Notably, PAF can induce expression of its own receptor in a positive feedback loop. This auto-induction requires intact TLR4, MyD88, and TRIF signaling components, as demonstrated in peritoneal macrophage studies . Environmental factors also influence Ptafr expression - gut microbiota significantly upregulates Ptafr mRNA levels, as evidenced by comparative studies between conventional and germ-free rats . Conversely, glucocorticoids like dexamethasone downregulate Ptafr transcription, partly through depletion of eosinophils in intestinal tissue .

What detection methods are most effective for studying rat Ptafr?

Multiple complementary approaches have proven effective for studying rat Ptafr:

  • mRNA detection: Competitive polymerase chain reaction (PCR) and in situ hybridization have been successfully employed to quantify and localize Ptafr mRNA in rat tissues .

  • Functional assays: PAF-induced calcium signaling and downstream pathway activation serve as indirect measures of receptor presence and activity.

  • Protein detection challenges: Studies have reported difficulties in detecting Ptafr protein due to the absence of suitable murine antibodies , making mRNA analysis and functional assays particularly important.

How does TLR signaling interact with Ptafr expression and function?

Research reveals a critical interdependence between TLR signaling components and Ptafr function:

  • In wild-type macrophages, PAF analog (cPAF) induces Ptafr expression, creating a positive feedback loop.

  • This auto-induction is completely abolished in TLR4-deficient macrophages.

  • Macrophages lacking MyD88 and TRIF show significantly suppressed Ptafr induction in response to cPAF.

  • Interestingly, direct TLR4 stimulation with LPS does not upregulate Ptafr, suggesting a specialized interaction rather than a general inflammatory cross-talk mechanism .

This relationship indicates that inflammatory signaling through PAF/Ptafr requires intact TLR4 components, establishing an important link between these pathways in inflammatory processes.

What phenotypic changes occur in Ptafr knockout rat models?

Ptafr knockout rats exhibit several distinct phenotypic changes compared to wild-type controls:

  • Weight regulation: Ptafr-/- animals gain weight excessively regardless of diet type. This becomes significant from the second week onward when fed either control or Western diet .

  • Feeding behavior: Knockout animals consume approximately 25% more food than wild-type controls (p=0.003), suggesting Ptafr involvement in appetite regulation .

  • Activity patterns: Ptafr-/- animals show significantly reduced physical activity during dark cycles, with approximately half as many lateral beam disruptions as wild-type animals .

  • Metabolic parameters: Despite behavioral differences, respiratory quotient and energy expenditure patterns remain similar between knockout and wild-type animals, indicating that direct metabolic alterations are not the primary mechanism for weight gain .

What is the role of Ptafr in neonatal necrotizing enterocolitis (NEC) models?

Ptafr plays a crucial role in the pathophysiology of NEC in neonatal rat models:

  • PAF acts as an important inflammatory mediator contributing to NEC development.

  • The PAF-degrading enzyme acetylhydrolase (PAF-AH) provides protection against NEC.

  • In experimental models, enteral administration of recombinant PAF-AH significantly reduces NEC incidence compared to controls (6/26 versus 19/26, p < 0.001) .

  • This protective effect is mediated locally in the intestine - enteral rPAF-AH administration results in significant intestinal PAF-AH activity without detectable circulation in plasma .

  • Immunohistochemistry confirms localization of administered rPAF-AH to intestinal epithelial cells, suggesting direct action at the mucosal surface .

How should researchers design experiments to investigate Ptafr signaling pathways?

When investigating Ptafr signaling, consider these experimental design principles:

  • Control for TLR pathway interaction: Include TLR4, MyD88, or TRIF knockout controls alongside Ptafr manipulations, as these components significantly affect Ptafr function .

  • Cell type considerations: Design experiments that account for cell-specific expression patterns. Eosinophils and epithelial cells show particularly high Ptafr expression in intestinal tissue .

  • Microbiota influence: Control for or manipulate gut microbiota when studying intestinal Ptafr, as germ-free rats show significantly less Ptafr expression and weaker responses to PAF than conventionally housed animals .

  • Temporal dynamics: Include time-course measurements when examining Ptafr expression changes, as auto-induction mechanisms create dynamic expression patterns .

  • Complementary approaches: Combine mRNA quantification, in situ localization, and functional assays to overcome limitations in protein detection due to antibody limitations .

What statistical approaches are most appropriate for analyzing Ptafr expression data?

Analysis of Ptafr expression requires robust statistical methods:

  • For detecting significant expression differences: Apply false discovery rate (FDR) calculations with a threshold of ≤ 0.10, combined with a minimum fold-change filter (typically ≥ 1.2) to identify biologically meaningful differences .

  • For comparisons across multiple models: Use two-factor linear modeling including interaction terms, where one factor might be experimental condition and the other factor the specific rat strain or model .

  • For expression data presentation: Present findings in table format similar to the example below from a gene expression study comparing different rat lines:

Table 1. Differential Gene Expression Across Rat Line-Pairs

Type of GenesP-NPsP-sNPHAD1-LAD1HAD2-LAD2AA-ANA
AcbSh Region
Named genes1772402157565127
Un-named genes28678239130
CeA Region
Named genes2934941585181
Un-named genes5110229870

Note: Table adapted from gene expression study methodology that can be applied to Ptafr research .

What are the main methodological challenges in studying Ptafr protein expression?

Researchers face several significant challenges when studying Ptafr at the protein level:

  • Antibody limitations: A major obstacle has been the absence of suitable murine antibodies for detecting rat Ptafr. Multiple studies report unsuccessful attempts to study PTAFR protein in immunoblots and tissues due to this limitation .

  • Membrane protein challenges: As a membrane-bound receptor, Ptafr presents typical technical difficulties associated with membrane protein isolation, including maintaining proper folding and functionality during extraction and analysis.

  • Detection sensitivity: Low expression levels in certain tissues require highly sensitive detection methods.

  • Heterogeneous expression: Cell-specific expression patterns demand techniques with cellular or subcellular resolution for accurate characterization.

  • Workaround strategies: Due to these challenges, researchers often rely on mRNA detection (qPCR, in situ hybridization) and functional assays rather than direct protein measurement .

How can researchers effectively validate Ptafr knockout models?

Thorough validation of Ptafr knockout models requires multiple approaches:

  • Genetic verification: Confirm the targeted modification through genomic PCR and sequencing.

  • Transcript analysis: Verify absence of Ptafr mRNA using qRT-PCR with primers spanning exon-exon junctions.

  • Functional assays: Test for loss of PAF-mediated calcium flux or other downstream signaling events in isolated cells from knockout animals.

  • Phenotypic confirmation: Evaluate whether expected physiological changes are present, such as:

    • Increased food intake (approximately 25% higher than wild-type)

    • Reduced physical activity during dark cycles

    • Progressive weight gain regardless of diet type

    • Altered response to inflammatory challenges involving PAF

  • Complementary approaches: Use pharmacological Ptafr antagonists alongside genetic models to confirm consistency of observed effects.

How does Ptafr influence metabolic regulation and feeding behavior?

Recent findings reveal unexpected roles for Ptafr in metabolic regulation:

  • Weight regulation: Ptafr-/- rats gain weight excessively over time, regardless of diet composition. This weight gain becomes significant from week two onward when fed either control or Western diet .

  • Behavioral mechanisms: The weight gain appears to be driven by two behavioral changes:

    • Increased food consumption: Ptafr-/- animals consume approximately 25% more food than controls

    • Decreased physical activity: Knockout animals show significantly less movement during dark cycles

  • Metabolic parameters: Despite weight differences, respiratory quotient and energy expenditure patterns remain similar between knockout and wild-type animals, indicating that fundamental metabolic processes are not primarily affected .

  • Expression correlations: Supporting these findings, obesity-resistant rats show higher PTAFR expression in liver compared to obesity-prone rats, suggesting a protective role against weight gain .

  • Research implications: These findings suggest potential therapeutic applications for Ptafr modulation in metabolic disorders, particularly those involving dysregulated appetite and physical activity.

What is the relationship between gut microbiota and Ptafr expression?

The interaction between gut microbiota and Ptafr represents a promising research frontier:

  • Expression differences: Germ-free rats have significantly less Ptafr mRNA than conventionally fed rats, demonstrating microbiota-dependent regulation .

  • Functional consequences: Germ-free rats show weaker physiological responses to PAF administration compared to conventionally fed rats .

  • Regulatory mechanisms: While exact mechanisms remain to be elucidated, the relationship likely involves innate immune signaling pathways, given the established interactions between TLR signaling components and Ptafr expression .

  • Future directions: This area warrants further investigation to determine:

    • Specific bacterial species or metabolites that most strongly influence Ptafr expression

    • Whether probiotics could modulate Ptafr-dependent inflammatory processes

    • How dietary interventions affect this microbiota-Ptafr relationship

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.