Recombinant Rat Potassium voltage-gated channel subfamily A member 1 (Kcna1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Recombinant Rat Kcna1 is produced using diverse expression platforms, each with distinct advantages:

Expression SystemAdvantagesApplications
HEK293 CellsProper glycosylation and trafficking Electrophysiology, drug screening
E. coliCost-effective, high yield Structural studies
Mammalian CellsNative post-translational modifications Functional assays
Wheat GermCell-free synthesis Antibody production

Functional Insights from Research

Electrophysiological Properties:

  • Activation: Rapid delayed rectifier currents with voltage-dependent gating .

  • Inactivation: Exhibits C-type inactivation, modulated by glycosylation status .

Pathogenic Mutations:

MutationFunctional ImpactPhenotype ObservedSource
N255DNonfunctional channel; dominant-negativeHypomagnesemia in renal tubules
F184CImpaired fast/slow inactivationEpisodic ataxia, myokymia
I262MReduced current densitySeizure susceptibility

Knockout Models:

  • Kcna1⁻/⁻ mice exhibit spontaneous seizures, hippocampal hyperexcitability, and neuropathology resembling temporal lobe epilepsy .

  • Altered auditory processing and vagus nerve dysfunction are reported in knockout models .

Applications in Research

Disease Modeling:

  • Epilepsy: Recombinant Kcna1 is used to study seizure mechanisms and test antisense oligonucleotides or gene therapy vectors (e.g., HSV1 amplicons) .

  • Episodic Ataxia: Mutant channels help elucidate ion channel dysfunction in movement disorders .

Drug Development:

  • Pharmacological targeting of Kv1.1-containing channels is explored for neuroinflammatory diseases (e.g., multiple sclerosis) .

  • Scorpion venom-derived peptides (e.g., from Mesobuthus eupeus) block Kv1.1 and serve as molecular tools .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your own applications.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcna1; Potassium voltage-gated channel subfamily A member 1; RBKI; RCK1; Voltage-gated potassium channel subunit Kv1.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcna1
Target Protein Sequence
MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTA TDQNCVNKSKLLTDV
Uniprot No.

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.
Gene References Into Functions
  1. Our findings provide direct evidence that N-glycans of Kv3.1 splice variants contribute to the placement of these glycoproteins in the plasma membrane of neuronal-derived cells while those of Kv1.1 were absent. PMID: 26348848
  2. This study demonstrated that kainic-acid induced status epilepticus there are two phases of Kv1.1 repression: (1) an initial mTOR-dependent repression of Kv1.1 that is followed by (2) a miR-129-5p persistent reduction of Kv1.1. PMID: 25270294
  3. This study supports the possibility of alpha subunits being precisely arranged in Kv1 channels, rather than being randomly assembled. PMID: 23725331
  4. Overexpression of miR-129 represses Kv1.1 mRNA translation when mTORC1 kinase is inhibited. PMID: 23836929
  5. Endogenous H2S generating enzyme cystathionine-beta-synthetase was co-localized well with Kv1.1 and Kv1.4 in trigeminal ganglion neurons. PMID: 23413915
  6. This study demonistrated that Kcna1-mutant rats dominantly display myokymia, neuromyotonia and spontaneous epileptic seizures. PMID: 22206926
  7. Our study provides evidence that K(V)1.1 contributes to the control of peripheral sensory nerve excitability PMID: 21903165
  8. Kv1.1 channels are expressed in the beta-cells of several species PMID: 21483673
  9. Our data suggest that altered Kv1.1(I400V) RNA editing contributes to the reduced ictogenic potential of 4-AP in chronic epileptic rats. PMID: 21371023
  10. Electro-pharmacological profile of a mitochondrial inner membrane big-potassium channel from rat brain PMID: 20974108
  11. Kv1.1 or 1.2 homomers and their concatenated forms between the pairs of adjacently and diagonally arranged heterotetramers show differential sensitivity to tetraethylammonium. PMID: 20805574
  12. Kv1.1 potassium channels apparently contribute to cell-autonomous death of retinal ganglion cells through different components of the apoptotic machinery. PMID: 19696788
  13. mutations in KCNA1 increase neurotransmitter release in episodic ataxia type 1 PMID: 19779067
  14. Selective blockade of T-lymphocyte K(Ca)3.1 and K(v)1.3 channels may represent a novel alternative therapy for prevention of kidney allograft rejection. PMID: 19715983
  15. N-glycosylation affected gating properties both by altering surface potential sensed by the channel's activation gating machinery and by modifying conformational changes regulating cooperative subunit interactions during activation and inactivation PMID: 12879861
  16. KCNE4 beta-subunit has a drastic inhibitory effect on currents generated by Kv1.1 and Kv1.3 potassium channels PMID: 12944270
  17. Kv1.1 and Kv1.3 channels make a significant contribution to K+ efflux at the apical membrane of the choroid plexus. PMID: 14602579
  18. Age-related changes in the distribution of Kv1.1 in auditory neuron rat cochlear nuclei. PMID: 15949244
  19. Kv 1.1 was found in cochlear nucleus neuronal cell bodies at birth and postnatal day 21 through adulthood, labeling for potassium channel was in axonal processes, whereas the number of cell bodies labeled for Kv 1.1 decreased. PMID: 16122713
  20. study shows that activation of presynaptic mu opioid receptors primarily attenuates GABAergic synaptic inputs to central nucleus of the amygdala-projecting neurons in the basolateral amygdala through a signaling mechanism involving Kv1.1 & Kv1.2 channels PMID: 16306173
  21. Kv1.1 is expressed in gastric epithelial cells and function as growth modulators. PMID: 16331678
  22. Consistent with these findings, strong immunoreactivities for Kv1.1 and Kv1.6, among 4-AP-sensitive and low-voltage-activated Kv1 family examined, were detected in the soma but not in the stem axon of MTN neurons. PMID: 16624997
  23. inhibition of mTOR increased Kv1.1 in hippocampal neurons & promoted Kv1.1 surface expression on dendrites without altering its axonal expression; synaptic excitation may cause local suppression of dendritic Kv1 channels by reducing their local synthesis PMID: 17023663
  24. Here we investigated the role of a highly conserved cytoplasmic C-terminal charged region of five amino acids (HRETE) of the S6 transmembrane domain in the protein and conductance expression of Kv1.1, Kv1.2, and Kv1.4 channels. PMID: 17520476
  25. Kv1.1 plays an important role in limiting AP firing and that siRNA may be a useful approach to establish the role of specific ion channels in the absence of selective antagonists. PMID: 17855588
  26. The numbers of Kv1.1 channel are higher in DRs than VRs. PMID: 18053989
  27. cofactor oxidation by Kvbeta1 is regulated by membrane potential, presumably via voltage-dependent structural changes in Kv1.1 channels PMID: 18222921
  28. In the rat cerebellar granule cell the protein kinase C pathway promotes neuronal apoptosis through an increase in the levels of expression of Kv1.1 alpha subunit. PMID: 18466331
  29. This study has revealed the specific expression of Kv1.1 in microglia AND was localized in the microglia in the rat brain between postnatal day 1 and day 10 then progressively reduced with age and was hardly detected at day 14 and day 21 in microglia. PMID: 19118603
  30. alterations of Kv1.1 and Kv2.1 might contribute to glutamate-induced toxicity in hippocampal neurons PMID: 19472219
Database Links

KEGG: rno:24520

STRING: 10116.ENSRNOP00000026731

UniGene: Rn.9769

Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.1/KCNA1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane. Cell projection, axon. Cytoplasmic vesicle. Perikaryon. Endoplasmic reticulum. Cell projection, dendrite. Cell junction. Cell junction, synapse. Cell junction, synapse, presynapse. Cell junction, synapse, presynaptic cell membrane.
Tissue Specificity
Detected in hippocampus, in the middle third of the molecular layer of the dentate gyrus and in stratum radiatum and stratum oriens. Detected in the mossy fiber zone in the hippocampus CA3 region, at or near axon terminals. Detected in brain cortex, at ba

Q&A

What is the molecular structure of Kcna1 and how does it contribute to neuronal function?

Kcna1 encodes the Kv1.1 α subunit, which is a core component of voltage-gated potassium channels. These channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. In native cells, Kv1.1 exists exclusively in heteromeric channels containing Kv1.2 and Kv1.4 α subunits along with auxiliary Kvβ1 and Kvβ2 subunits . The formation of these heteromeric complexes is critical for proper channel function, as they modulate the characteristics of the channel-forming alpha-subunits.

Functionally, Kv1.1-containing channels regulate diverse physiological processes including neurotransmitter release, neuronal excitability, and action potential properties. The potassium currents mediated by these channels help establish resting membrane potential and control the frequency and pattern of action potential firing. When expressed in heterologous systems, Kv1.1 α subunits form homotetrameric channels that mediate delayed rectifier potassium currents .

How does the native distribution of Kv1.1 channels inform recombinant expression studies?

Immunocytochemical studies have revealed that Kv1.1-containing potassium channels are predominantly localized to axons (specifically the juxta-paranodal regions of myelinated axons and fine non-myelinated axons) and axon terminals in the hippocampus and cerebellum . This specialized distribution pattern is essential for researchers to consider when designing experiments with recombinant Kcna1.

When developing recombinant expression systems, researchers should account for the native subcellular targeting mechanisms. The co-assembly of Kv1.1 with other Kv1 family members and auxiliary subunits significantly affects intracellular trafficking and surface expression efficiency. Studies have demonstrated that Kv1.1 homotetramers are predominantly retained intracellularly, while Kv1.1-containing heterotetramers are efficiently expressed on the cell surface . This suggests that co-expression with appropriate partner subunits is critical for achieving physiologically relevant recombinant channel expression.

What are the functional consequences of altered Kcna1 expression in neuronal systems?

The functional significance of Kcna1 has been elegantly demonstrated through knockout mouse models. Deletion of the Kcna1 gene results in mice that exhibit frequent recurrent spontaneous seizures beginning 2-4 weeks postnatally, consistent with the developmental expression pattern of the gene . These seizures display many characteristics of temporal lobe seizures, suggesting that limbic structures, particularly the hippocampus, play an important role in the resulting epileptic phenotype.

Electrophysiological studies in Kcna1 knockout models have revealed:

  • Increased neuronal excitability, particularly in the medial nucleus of the trapezoid body, caused by a decrease in low-voltage activated current (IKL)

  • Abnormal action potential conduction in peripheral nerves

  • Reduced evoked seizure thresholds

  • Changes in spike frequency and timing precision (jitter)

These findings highlight the critical role of Kv1.1 in regulating neuronal excitability and network synchronization, providing important context for interpreting results from recombinant Kcna1 studies.

What expression systems are most effective for studying recombinant Kcna1 channels?

For homomeric Kv1.1 channel studies:

  • Heterologous expression often results in intracellular retention of Kv1.1 homotetramers

  • Co-expression with chaperone proteins may improve surface expression

  • Lower expression temperatures (30°C instead of 37°C) can enhance functional expression in mammalian cells

For heteromeric channel studies:

  • Co-expression with Kv1.2, Kv1.4, and/or Kvβ subunits significantly improves surface expression

  • Control of subunit stoichiometry requires careful optimization of transfection ratios

  • Verification of heteromeric assembly is essential through biochemical or electrophysiological approaches

The choice of expression vector is also critical. For viral vector-mediated expression, HSV1 amplicon vectors have been successfully used to express the rat Kcna1 gene in hippocampal neurons . This approach is particularly valuable for gene transfer studies in animal models of epilepsy.

How can researchers verify the functional properties of recombinant Kcna1 channels?

Verification of recombinant Kcna1 function requires a combination of electrophysiological, biochemical, and imaging techniques:

  • Electrophysiological characterization:

    • Whole-cell patch clamp to measure macroscopic potassium currents

    • Single-channel recordings to analyze unitary channel properties

    • Voltage protocols to determine activation/inactivation kinetics and voltage dependence

  • Biochemical verification:

    • Western blotting to confirm protein expression

    • Co-immunoprecipitation to verify subunit associations

    • Surface biotinylation to quantify plasma membrane expression

  • Imaging approaches:

    • Immunocytochemistry to visualize channel distribution

    • Fluorescently-tagged constructs to monitor trafficking in live cells

    • Super-resolution microscopy to examine nanoscale localization patterns

When interpreting electrophysiological data, researchers should note that the biophysical properties of recombinant Kv1.1 channels are significantly influenced by subunit composition. For example, co-assembly of Kv1.1 with Kv1.4 and/or Kvβ subunits in heterologous systems gives rise to channel properties distinct from those composed of Kv1.1 alone, transforming delayed rectifier currents to A-type currents .

What are the critical considerations when using recombinant Kcna1 for structure-function studies?

Structure-function studies of recombinant Kcna1 require careful experimental design to yield meaningful insights:

  • Mutagenesis approaches:

    • Site-directed mutagenesis should target specific functional domains (voltage sensor, pore region, tetramerization domain)

    • Disease-associated mutations provide valuable insights into structure-function relationships

    • Conservative vs. non-conservative substitutions offer different levels of information

  • Functional assessment methods:

    • Detailed voltage-clamp protocols to isolate specific gating parameters

    • Temperature sensitivity studies to examine energetics of channel gating

    • Pharmacological profiling with subtype-selective channel blockers

  • Structural considerations:

    • Co-expression with appropriate auxiliary subunits is essential for native-like function

    • Post-translational modifications significantly impact channel properties

    • Protein-protein interactions may modulate channel behavior

When designing recombinant constructs, researchers should consider that NADPH binding to Kv1.1-containing channels is required for efficient down-regulation of potassium channel activity . Additionally, oxidation of bound NADPH strongly decreases N-type inactivation of potassium channel activity, suggesting that redox state is an important variable to control in recombinant studies.

How do Kcna1 knockout models advance our understanding of epilepsy mechanisms?

The Kcna1 knockout mouse model provides valuable insights into epilepsy mechanisms and has been extensively characterized:

Video/EEG monitoring of Kcna1-/- mice has confirmed both interictal abnormalities and seizure occurrence. Neuropathological assessment revealed that hippocampal damage (detected by silver staining) and reorganization (detected by Timm staining) occurred only after animals had exhibited severe prolonged seizures (status epilepticus) . This suggests that the absence of Kv1.1 channels predisposes to seizures, while the hippocampal pathology is a consequence rather than a cause of severe seizures.

The seizure phenotype in Kcna1-/- mice exhibits several important features:

  • Onset at 2-4 weeks postnatally, aligning with developmental Kcna1 expression

  • Behavioral characteristics similar to temporal lobe seizures (initial "freezing," then sniffing and licking, rearing, progressing through forelimb clonus and generalized tonic-clonic seizures)

  • Reduced thresholds for evoked seizures

  • Electrographic abnormalities consistent with limbic epilepsy

These characteristics make the Kcna1 knockout model particularly valuable for investigating temporal lobe epilepsy mechanisms and for testing potential therapeutic interventions.

What methodological approaches are most effective for studying Kcna1 gene replacement therapies?

Gene replacement strategies for Kcna1-related disorders represent a promising therapeutic direction. The methodological considerations for such studies include:

  • Vector selection:

    • HSV1 amplicon vectors have been successfully used to transfer the rat Kcna1 gene into hippocampal neurons

    • These vectors can carry both the Kcna1 gene and reporter genes like E. coli lacZ

    • The choice of promoter is critical for achieving appropriate expression levels

  • Delivery methods:

    • Direct bilateral injection into hippocampus has been demonstrated, though infection patterns can be variable

    • The granule cells of the hippocampus appear particularly amenable to infection

    • Quantitative assessment of transduction efficiency is essential

  • Functional assessment:

    • Immunocytochemical verification of ectopic Kv1.1 expression

    • Electrophysiological recording to confirm functional channel activity

    • Behavioral and EEG monitoring to evaluate seizure outcomes

Researchers should note that vector-mediated Kcna1 gene transfer into hippocampus has shown variable neuronal infection rates across subjects, highlighting the need for optimization of delivery methods . Additionally, expression patterns may differ from native Kv1.1 distribution, potentially resulting in "ectopic" channel expression that might have unintended consequences.

How can researchers correlate Kcna1 channel dysfunction with specific epilepsy phenotypes?

Establishing correlations between Kcna1 channel dysfunction and epilepsy phenotypes requires multi-level analysis:

  • Molecular characterization:

    • Expression level quantification using RT-PCR, Western blotting, and immunohistochemistry

    • Analysis of compensatory changes in related ion channel subunits

    • Assessment of heteromeric channel composition

  • Cellular electrophysiology:

    • Patch-clamp recording of neuronal excitability properties

    • Analysis of action potential waveforms, firing patterns, and threshold

    • Evaluation of synaptic transmission in affected circuits

  • Network activity:

    • In vivo EEG recordings to characterize seizure patterns

    • Analysis of interictal abnormalities

    • Correlation of electrographic patterns with behavioral manifestations

Importantly, evidence suggests that ablation of Kcna1 does not result in compensatory changes in expression levels of other related ion channel subunits . This finding highlights the non-redundant role of Kv1.1 channels in neuronal function and explains why the knockout phenotype is so severe despite the presence of other Kv1 family members.

What cutting-edge techniques are available for visualizing Kcna1 trafficking and localization?

Advanced imaging approaches for studying Kcna1 trafficking and localization include:

  • Super-resolution microscopy techniques:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Single-molecule localization microscopy (SMLM)

    These approaches overcome the diffraction limit of conventional microscopy, allowing visualization of channels at the nanoscale level and enabling study of their clustering and colocalization with other proteins.

  • Live-cell imaging strategies:

    • Fluorescent protein tagging with minimal functional disruption

    • Quantum dot labeling of surface channels

    • pH-sensitive fluorescent tags to distinguish surface from intracellular channels

  • Electron microscopy methods:

    • Immunogold labeling for ultrastructural localization

    • Freeze-fracture replica immunolabeling (FRIL) for membrane protein distribution

    • Serial block-face scanning electron microscopy for 3D reconstruction

For ultrastructural localization studies, researchers have successfully used immunocytochemical methods to localize the distribution of Kv1.1 channels in hippocampal neurons of wild-type mice and to determine the localization of newly expressed Kv1.1 channels following HSV infection in Kv1.1 knockout mice .

How can researchers effectively study interactions between Kcna1 and auxiliary subunits?

Studying the complex interactions between Kcna1 and its auxiliary subunits requires specialized approaches:

  • Biochemical interaction analysis:

    • Co-immunoprecipitation to verify physical association

    • Proximity labeling methods (BioID, APEX) to identify novel interacting partners

    • Cross-linking mass spectrometry to map interaction interfaces

  • Functional analysis:

    • Heterologous co-expression with systematic mutation of interaction domains

    • Electrophysiological characterization of heteromeric channels

    • Trafficking studies to assess subunit-dependent localization

  • Structural biology approaches:

    • Cryo-electron microscopy of channel complexes

    • X-ray crystallography of purified channel assemblies

    • Molecular dynamics simulations to predict interaction energetics

When designing these studies, researchers should consider that Kv1.1 α subunits in native tissues exist exclusively in heteromeric channels containing Kv1.2 and Kv1.4 α subunits and Kvβ1 and Kvβ2 auxiliary subunits . The Kvβ subunits play critical roles in modulating channel properties, with Kvβ1 mediating closure of delayed rectifier potassium channels by physically obstructing the pore via its N-terminal domain and increasing the speed of channel closure .

What are the most effective approaches for studying the role of Kcna1 in specialized neuronal compartments?

Investigating the compartment-specific roles of Kcna1 requires targeted experimental strategies:

  • Subcellular targeting approaches:

    • Addition of targeting motifs to direct recombinant channels to specific compartments

    • Compartment-specific promoters to drive expression in dendrites vs. axons

    • Optogenetic control of channel function in defined neuronal regions

  • Electrophysiological recording strategies:

    • Cell-attached patches from visualized axons or terminals

    • Dual soma-axon recordings to examine action potential propagation

    • Local pharmacological manipulation of channel function

  • Compartment-specific proteomics:

    • Laser capture microdissection combined with mass spectrometry

    • Proximity labeling in defined neuronal compartments

    • Subcellular fractionation to isolate axonal vs. dendritic membranes

Previous studies have shown that Kv1.1-containing potassium channels are predominantly localized to axons (juxta-paranodal regions of myelinated axons and fine non-myelinated axons) and axon terminals in hippocampus and cerebellum . This specialized distribution suggests that Kv1.1 plays critical roles in regulating action potential propagation and neurotransmitter release, making compartment-specific studies particularly valuable.

How can single-cell omics approaches advance our understanding of Kcna1 regulation?

Single-cell technologies offer unprecedented insights into Kcna1 regulation:

  • Single-cell transcriptomics:

    • RNA-seq to identify cell type-specific expression patterns

    • Patch-seq to correlate channel expression with electrophysiological properties

    • Spatial transcriptomics to map expression across brain regions

  • Single-cell proteomics:

    • Mass cytometry to quantify protein levels in individual cells

    • Nanoscale imaging mass spectrometry for spatial proteomics

    • Single-cell western blotting for protein quantity and modification state

  • Multi-omic integration:

    • Combined analysis of transcriptome, proteome, and electrophysiology data

    • Machine learning approaches to identify regulatory patterns

    • Network analysis to reveal co-regulated gene modules

These approaches can reveal how Kcna1 expression varies across neuronal subtypes and how this heterogeneity contributes to circuit function and dysfunction in epilepsy models.

What are the challenges and solutions for studying post-translational modifications of Kcna1?

Post-translational modifications significantly impact Kcna1 function:

  • Identification methodologies:

    • Mass spectrometry-based proteomics to map modification sites

    • Modification-specific antibodies for western blotting and immunocytochemistry

    • Biochemical assays to quantify modification levels

  • Functional analysis:

    • Site-directed mutagenesis of modification sites

    • Pharmacological manipulation of modifying enzymes

    • In vitro enzymatic assays to reconstitute modifications

  • Temporal dynamics:

    • Activity-dependent changes in modification state

    • Development-related modification patterns

    • Disease-associated alterations in channel modifications

Researchers should note that NADPH binding to Kv1.1-containing channels significantly affects channel function, and oxidation of bound NADPH strongly decreases N-type inactivation of potassium channel activity . This highlights the importance of studying redox-dependent modifications in particular.

How can in vivo optogenetic and chemogenetic approaches complement recombinant Kcna1 studies?

Advanced in vivo manipulation technologies offer powerful complements to traditional recombinant studies:

  • Optogenetic strategies:

    • Light-activated potassium channels to mimic Kv1.1 function

    • Optogenetic control of Kv1.1 expression using light-responsive transcription factors

    • Integration with fiber photometry for closed-loop manipulation

  • Chemogenetic approaches:

    • Designer receptors exclusively activated by designer drugs (DREADDs) to modulate circuits affected by Kv1.1 dysfunction

    • Chemical-genetic approaches to selectively inhibit or activate engineered Kv1.1 channels

    • Drug-inducible expression systems for temporal control of Kcna1 replacement

  • In vivo monitoring:

    • Genetically-encoded voltage indicators to visualize neuronal activity

    • Calcium imaging to monitor network dynamics

    • Simultaneous manipulation and recording for real-time analysis

These approaches allow researchers to move beyond static replacement of Kcna1 and toward dynamic, circuit-specific modulation of potassium channel function, potentially leading to more precise therapeutic strategies for Kcna1-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.