Recombinant Rat Potassium voltage-gated channel subfamily A member 2 (Kcna2)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Two primary production strategies are employed:

Bacterial Expression

  • System: E. coli BL21(DE3) strain

  • Yield: ~0.5-1.0 mg/L culture

  • Purification: Ni-NTA affinity chromatography under denaturing conditions

  • Formulation: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Mammalian Expression

  • System: HEK-293 cells with AAV9 vectors

  • Advantages: Proper post-translational modifications and membrane localization

  • Applications: In vivo electrophysiology studies using rat CHF models

Cardiac Arrhythmia Mechanisms

In congestive heart failure (CHF) models:

  • Kcna2 downregulation: Reduces slow delayed rectifier potassium current (IKsI_{Ks}) by 41%, prolonging action potential duration (APD) from 68.77 ms to 98.46 ms .

  • AAV9-Kcna2 rescue: Restores IKsI_{Ks} density to 85% of baseline and shortens QT intervals from 232.62 ms to 184.40 ms .

ParameterControl RatsCHF RatsCHF + Kcna2 Overexpression
IKsI_{Ks} Density1.0 pA/pF0.59 pA/pF0.85 pA/pF
Ventricular APD9068.77 ms98.46 ms79.33 ms
Arrhythmia Incidence12%67%29%

Neurological Implications

  • Loss-of-function mutations: Cause epileptic encephalopathy with 85% seizure recurrence by age 3 .

  • Gain-of-function variants: Induce neuronal hyperpolarization (-85 mV baseline → -92 mV) .

Research Applications

Disease Modeling

  • Cardiac: CHF-induced ventricular arrhythmia mechanisms

  • Neurological: Kcna2 knockout mice exhibit ataxia and reduced Purkinje cell firing (12 Hz vs. 45 Hz in wild types) .

Drug Development

  • Target for Class III antiarrhythmics (e.g., amiodarone)

  • Modulators tested: 4-aminopyridine (EC₅₀ = 1.2 μM)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please clearly indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend consulting your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure all contents are at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the specific protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquot the protein to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the protein with your specified tag.
Synonyms
Kcna2; Potassium voltage-gated channel subfamily A member 2; RAK; RBK2; RCK5; Voltage-gated potassium channel subunit Kv1.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-499
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcna2
Target Protein Sequence
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA NCTLANTNYVNITKMLTDV
Uniprot No.

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Its function is crucial for preventing aberrant action potential firing and regulating neuronal output. The protein forms tetrameric potassium-selective channels through which potassium ions traverse in accordance with their electrochemical gradient. The channel undergoes transitions between open and closed conformations in response to changes in the membrane voltage. It can form both functional homotetrameric channels and heterotetrameric channels with varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and potentially other family members. The specific channel properties are influenced by the alpha subunit composition. Modulation of channel properties is further achieved by cytoplasmic beta subunits that regulate the subcellular localization of alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In biological settings, membranes likely contain a mixture of heteromeric potassium channel complexes, making it challenging to definitively attribute currents observed in intact tissues to a particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous closure. In contrast, a heteromultimer composed of KCNA2 and KCNA4 exhibits rapid inactivation. The differential response to toxins specific for KCNA1 and KCNA2 suggests that heteromeric potassium channels incorporating both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. KCNA2-containing channels contribute to presynaptic function, preventing hyperexcitability and aberrant action potential firing. Studies involving toxins selective for KCNA2-containing potassium channels have indicated that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, thereby suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials. This plays a crucial role in motor coordination. This protein is involved in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. It may function as a downstream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. It may also contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Additionally, this protein contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced expression of KCNA2 is linked to the perception of neuropathic pain following peripheral nerve injury, but not acute pain. It plays a role in regulating the duration of non-rapid eye movement (NREM) sleep.
Gene References Into Functions
  1. Findings suggest that increased dorsal horn DNMT3a contributes to bone cancer pain through silencing dorsal horn Kv1.2 expression PMID: 29056068
  2. Ventricular Kcna2 AS expression increases in rats with CHF and contributes to reduced IKs, prolonged APs, and the occurrence of ventricular arrhythmias by silencing Kcna2. PMID: 29263036
  3. Data indicate that in cryo-electron microscopy (cryo-EM) images of the relatively small Kv1.2 channel complex, the protein particle's contribution is quite weak compared to the membrane density. PMID: 26835990
  4. The dynamics of the ion conduction processes in the Kv1.2 pore domain PMID: 26950215
  5. Kv1.2 mediates heterosynaptic modulation of direct cortical synaptic inputs in CA3 pyramidal cells PMID: 26047212
  6. An R300C mutation creates a large cavity in the voltage sensing domain. PMID: 25588216
  7. Data suggest that exercise training reverses the pathological expression of the Kv1.2, Kv1.5, and BKCa channels in aortic myocytes from spontaneously hypertensive rats. PMID: 25661478
  8. A majority of dorsal root ganglion (DRG) neurons were positive for Kv channel alpha subunit Kv1.2. PMID: 24472174
  9. The alpha subunit of Kv1.2 channels determines the pharmacological characteristics of potassium channel blockers by their position in the channel. PMID: 23725331
  10. Cell-surface Kv1.2 alpha-subunit levels are controlled by secretin-regulated Kv1.2 endocytic trafficking. PMID: 22764231
  11. Myelin regulates both trafficking and activity of Kv1 channels along hippocampal axons through TAG-1 PMID: 21602278
  12. Kv1.1 or 1.2 homomers and their concatenated forms between the pairs of adjacently and diagonally arranged heterotetramers show differential sensitivity to tetraethylammonium. PMID: 20805574
  13. Proper amounts of Kv1 channels and their associated proteins are required for efficient transport of Kv1 channel proteins along axons PMID: 20694152
  14. Results indicate that the extreme C-terminal end of the S6 inner helix plays an important regulatory role in the activation of the C-terminal-truncated Kv1.2 channel. PMID: 19947938
  15. Analysis of full-length Shaker potassium channel Kv1.2 structure by normal-mode-based X-ray crystallographic refinement PMID: 20534430
  16. Atomic-resolution observations of permeation and gating in a K(+) channel, based on molecular dynamics simulations of the Kv1.2 pore domain PMID: 20231479
  17. Kv1.2 channels have general presynaptic function in suppressing terminal hyperexcitability during depolarising after-potential PMID: 12777451
  18. Crystal structure, at a resolution of 2.9 angstroms PMID: 16002581
  19. Kv 1.2 was found in cochlear nucleus neuronal cell bodies at birth and postnatal day 21 through adulthood, labeling for potassium channel was in axonal processes, whereas the no cell bodies labeled for Kv 1.2. PMID: 16122713
  20. Study shows that activation of presynaptic mu opioid receptors primarily attenuates GABAergic synaptic inputs to central nucleus of the amygdala-projecting neurons in the basolateral amygdala through a signaling mechanism involving Kv1.1 & Kv1.2 channels PMID: 16306173
  21. Results suggest that amino acids in the pore region help regulate ion permeability or cellular trafficking by affecting glycosylation of Kv1.2. PMID: 16770729
  22. Enhanced nitrosative stress in diabetes mellitus contributes to Kcna2 channel dysfunction in the coronary microcirculation, which may be restored by ebselen. PMID: 17675568
  23. Data show that in the KcsA potassium channel, the number and strength of hydrogen bonds between residues in the selectivity filter and pore helix determine the rate and extent of C-type inactivation, which can also be engineered in Kv1.2 channels. PMID: 17922012
  24. Impairment of cAMP-mediated endothelium independent vasodilation of rat small coronary artery by STZ-induced diabetes was resulted from decrease of mRNA and protein expressions of Kv channels, and which leads to a reduced current from Kv channels PMID: 17982915
  25. Cluster of cytoplasmic C-terminal phosphorylation sites regulates Kv1.2 trafficking PMID: 18056633
  26. Expression of Kv1.2, Kv1.5, and Kv2.1 was higher in mesenteric arteries but was not different in aortas of SHR rats as compared to WKY rats PMID: 18174882
  27. R294H, A351H mutagenesis and also in combination with D352G, E353S mutations (oocytes expression)show intersubunit histidine metallic bridges formed between the first arginine of S4 (R294) and residues A351 or D352 of the pore domain PMID: 18504314
  28. We conclude that Kv1.2 in microglia modulates IL-1beta and TNF-alpha expression and ROS production probably by regulating the intracellular potassium concentration. PMID: 18627436
  29. The Kv1.2 channel exhibits functional properties that are distinct from Kv1.2 channels reported in the literature. PMID: 18638484
  30. The dynamic interaction of the C-terminus with the S4-S5 linker from a neighboring subunit of the Kv1.2 channel provides a mechanism for its C-terminus to regulate the channel activation PMID: 19247844

Show More

Hide All

Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.2/KCNA2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane. Cell projection, axon. Cell junction, synapse. Cell junction, synapse, synaptosome. Cell junction, synapse, presynaptic cell membrane. Cell projection, dendrite. Endoplasmic reticulum membrane. Cell projection, lamellipodium membrane. Endosome. Perikaryon. Cell junction, paranodal septate junction.
Tissue Specificity
Detected in neurons in dorsal root ganglion. Detected in hippocampus neurons. Detected on neurons of the anteroventral cochlear nucleus. Detected in renal arteries. Detected in neurons of the medial nucleus of the trapezoid body. Detected in neurons in th

Q&A

What is the functional role of KCNA2 in neuronal physiology?

KCNA2 encodes the KV1.2 potassium channel, which belongs to the delayed rectifier class of potassium channels that enable efficient neuronal repolarization following an action potential . These channels are essential for stabilizing the membrane potential after neurons fire, helping to control neuronal excitability .

Loss-of-function mutations predict hyperexcitable neuronal membranes and repetitive neuronal firing due to impaired repolarization . This hypothesis is corroborated by the epileptic phenotype observed in Kcna2 knock-out mice . KCNA2 expression has been detected in a broad range of both excitatory and inhibitory neurons, suggesting widespread importance in neural circuits .

When examining neuronal function experimentally, researchers should account for:

  • Membrane potential stability

  • Action potential frequency

  • Repolarization kinetics

  • Network-level excitability changes

What are the different types of KCNA2 mutations and their functional consequences?

KCNA2 mutations can be classified into two main categories based on their functional impact:

Loss-of-function mutations:

  • Result in almost complete loss of channel function with a dominant-negative effect

  • Associated with febrile and multiple afebrile, often focal seizure types

  • Present with multifocal epileptiform discharges strongly activated by sleep

  • Often accompanied by mild-moderate intellectual disability and delayed speech development

  • May include ataxia in some cases

Gain-of-function mutations:

  • Create permanently open channels at physiological membrane potentials

  • Lead to electrical silencing by membrane hyperpolarization

  • Associated with a more severe epileptic encephalopathy phenotype

  • Notable mutations such as R297Q and L298F demonstrate this mechanism

This bidirectional pathophysiology demonstrates that precise regulation of KCNA2 function is critical, as both increased and decreased activity can lead to neurological disorders, albeit with distinct characteristics .

What experimental models are commonly used to study KCNA2 function?

Researchers employ several experimental systems to investigate KCNA2:

  • Xenopus laevis oocytes: The most widely used heterologous expression system for electrophysiological characterization of KCNA2 variants. Wild-type and mutant KCNA2 cRNA is injected into oocytes, followed by two-microelectrode voltage clamp recordings to measure channel function . This approach allows for precise comparison of current amplitudes and channel kinetics between wild-type and mutant channels.

  • Mammalian cell lines: Transfection of KCNA2 constructs into cell lines enables studies of trafficking, protein expression, and function in a mammalian cellular context.

  • Animal models:

    • Kcna2 knock-out mice exhibit epileptic phenotypes, providing in vivo validation of channel function

    • AAV-mediated gene delivery systems for manipulating KCNA2 expression in specific tissues

  • Patient-derived samples: Analysis of mutations identified in patients with epileptic encephalopathies or other neurological disorders .

For comprehensive investigation, researchers should consider combining multiple models to validate findings across different experimental systems.

How is KCNA2 expression regulated in neuronal tissue?

KCNA2 expression is regulated through multiple mechanisms:

  • Transcriptional regulation: Developmental and brain region-specific expression patterns suggest precise transcriptional control, though specific factors governing this regulation in neurons remain incompletely characterized.

  • Post-transcriptional regulation by antisense RNA: A significant regulatory mechanism involves Kcna2 antisense RNA (Kcna2 AS), a 2.52-kb native long noncoding RNA complementary to Kcna2 mRNA . This antisense transcript specifically silences Kcna2 expression and has been shown to participate in the regulation of neuronal excitability .

  • Post-translational modifications: Various modifications affect channel trafficking, membrane insertion, and functional properties.

  • Activity-dependent regulation: Changes in neuronal activity can influence KCNA2 expression and function, creating feedback mechanisms that help maintain appropriate excitability.

The discovery of Kcna2 AS opens new research avenues for understanding endogenous regulation of KCNA2 and potential therapeutic approaches targeting this regulatory mechanism rather than the channel itself .

How do specific KCNA2 mutations correlate with distinct clinical phenotypes?

Genotype-phenotype correlations in KCNA2-related disorders reveal patterns that inform both diagnosis and therapeutic approaches:

Mutation TypeFunctional EffectClinical PhenotypeEEG FindingsAdditional Features
Loss-of-functionDominant-negative effect on wild-type channelsFebrile and multiple afebrile seizures, often focalMultifocal epileptiform discharges activated by sleepMild-moderate intellectual disability, delayed speech, sometimes ataxia
Gain-of-function (e.g., R297Q, L298F)Permanently open channelsMore severe epileptic encephalopathyVariable patternsOften includes ataxia, more profound developmental impacts
Dominant inheritance (e.g., p.255_257del)VariesEpisodic ataxia, mild infantile-onset seizures, later generalized and focal epilepsiesVariableNormal intellect in some cases

Recurrent mutations have been observed in unrelated individuals with similar phenotypes, suggesting mutational hotspots or specific functional consequences that reliably produce certain clinical features .

This correlation between mutation type and clinical presentation has important implications for both diagnostic classification and potential therapeutic strategies tailored to the specific functional defect.

What is the role of KCNA2 antisense RNA in regulating KCNA2 expression and function?

KCNA2 antisense RNA (Kcna2 AS) represents a sophisticated endogenous regulatory mechanism with significant implications for both normal physiology and pathological conditions:

Kcna2 AS is a 2.52-kb long noncoding RNA that is complementary to Kcna2 mRNA . Research has established that it functions as a biologically active regulator of Kcna2 expression, specifically silencing the channel.

In cardiovascular research, Kcna2 AS expression increases approximately 1.7-fold in rats with congestive heart failure (CHF) and in models of cardiomyocyte hypertrophy . This upregulation contributes to:

  • Reduced KCNA2 expression

  • Decreased slow component of the delayed rectifier potassium current (IKs)

  • Prolonged action potentials

  • Increased susceptibility to ventricular arrhythmias

Experimental inhibition of Kcna2 AS via siRNA approaches can increase KCNA2 expression, mitigating the reduction in IKs and the prolongation of action potentials both in vivo and in vitro, consequently reducing ventricular arrhythmias .

Although initially characterized in cardiovascular contexts, this regulatory mechanism likely extends to neuronal tissues, where it may contribute to the regulation of neuronal excitability and potentially to pathological states associated with altered KCNA2 function.

How can functional analysis of KCNA2 variants help classify their pathogenicity?

Functional characterization of KCNA2 variants provides essential information for determining pathogenicity:

Methodological approach for functional analysis:

  • Site-directed mutagenesis to introduce variants into wild-type KCNA2 cDNA

  • In vitro transcription to generate cRNA for oocyte injection or transfection into mammalian cells

  • Electrophysiological recording to assess channel properties:

    • Current amplitude compared to wild-type

    • Voltage-dependence of activation and inactivation

    • Channel kinetics

    • Dominant-negative effects when co-expressed with wild-type channels

Classification based on functional data:

  • Complete loss of function: <10% of wild-type current (e.g., G60E mutation showing ~5% of normal current)

  • Partial loss of function: Reduced current with preserved biophysical properties (e.g., W150C with ~20% of wild-type current)

  • Gain of function: Enhanced activity or altered biophysical properties (e.g., R297Q causing permanently open channels)

  • Dominant-negative effect: Mutant subunits impair function of wild-type subunits when co-expressed

This functional characterization helps distinguish pathogenic variants from benign polymorphisms and may guide the development of targeted therapeutic approaches based on the specific functional defect.

What methodological approaches are used to investigate contradictions in KCNA2 functional data?

Researchers face several challenges when investigating contradictory functional data related to KCNA2:

Causes of contradictory functional data:

  • Experimental system differences: Results from Xenopus oocytes may differ from mammalian cell lines or neurons

  • Methodological variations: Recording conditions, expression levels, and analysis methods

  • Complex subunit interactions: KCNA2 forms heteromeric channels with other Kv1 family members, with composition varying across cell types

  • Developmental context: Channel expression and function change throughout development

Methodological approaches to resolve contradictions:

  • Multi-system validation: Test the same mutation in multiple expression systems

  • Combined in vitro/in vivo approaches: Correlate heterologous expression data with animal model phenotypes

  • Comprehensive electrophysiological protocols: Assess multiple channel properties under standardized conditions

  • Co-expression studies: Evaluate effects in the context of other channel subunits

  • Correlation with clinical data: Compare functional results with phenotypes from multiple patients with the same mutation

When multiple lines of evidence converge, researchers can more confidently classify variants and understand their pathogenic mechanisms. This multimodal approach helps resolve apparent contradictions and provides more robust functional characterization.

How do mutations in KCNA2 affect its interactions with other ion channels in neuronal excitability?

KCNA2 functions within a complex network of ion channels that collectively determine neuronal excitability:

  • Co-assembly with other Kv1 family members:

    • KCNA2 (Kv1.2) forms heteromeric channels with other Kv1 subunits

    • Mutations may disrupt normal heteromeric assembly

    • The stoichiometry of these heteromers influences channel properties

  • Functional coupling with sodium channels:

    • KCNA2 channels counterbalance sodium influx during action potentials

    • Loss-of-function mutations can lead to prolonged sodium channel availability

    • This imbalance promotes hyperexcitability and epileptiform activity

  • Impact on calcium-dependent processes:

    • By modulating action potential duration, KCNA2 indirectly affects calcium channel activation

    • This influences neurotransmitter release and calcium-dependent signaling pathways

  • Compartment-specific interactions:

    • KCNA2 localization varies across neuronal compartments (soma, axon initial segment, nodes of Ranvier)

    • In each location, it interacts with different complements of ion channels

    • Mutations may have location-specific effects on neuronal function

Understanding these complex interactions requires sophisticated approaches combining electrophysiology, imaging, and computational modeling. The differential expression of KCNA2 in both excitatory and inhibitory neurons adds further complexity, as the same mutation may have opposite effects depending on the neuronal population .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.