Recombinant Rat Potassium voltage-gated channel subfamily A member 3 (Kcna3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Potassium Voltage-Gated Channel Subfamily A Member 3 (Kcna3)

Recombinant Rat Kcna3 is a synthetic version of the voltage-gated potassium channel encoded by the Kcna3 gene in rats. This protein belongs to the shaker-related subfamily of potassium channels, characterized by six transmembrane domains and a pore-forming region that facilitates potassium ion efflux . The recombinant form is engineered for research purposes, typically expressed in heterologous systems like E. coli, yeast, baculovirus, or mammalian cells .

Key Features

AttributeSpecificationSource
Gene NameKcna3
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE)
FunctionVoltage-dependent K⁺ efflux; delayed rectifier

Production and Purification Methods

Recombinant Rat Kcna3 is produced via heterologous expression systems, with purification methods tailored to host systems:

Host SystemAdvantagesLimitations
E. coliHigh yield, cost-effectivePotential improper folding
Mammalian CellsNative post-translational modificationsHigher cost, lower scalability

Purification typically involves affinity chromatography (e.g., His-tagged proteins) followed by size-exclusion chromatography . Purity is validated via SDS-PAGE or Western blotting .

Research Applications

Recombinant Rat Kcna3 is employed in:

  1. Ion Channel Pharmacology: Testing blockers (e.g., scorpion toxins, small molecules) to understand voltage-gated potassium channel modulation .

  2. Immune Cell Studies: Investigating Kcna3's role in T-cell activation, cytokine production, and autoimmune responses .

  3. Structural Biology: Crystallization studies to resolve channel gating mechanisms .

Example Research Workflow

  1. Expression: Induce recombinant Kcna3 production in E. coli or CHO cells.

  2. Purification: Isolate the protein using nickel affinity columns.

  3. Functional Assays: Measure K⁺ flux via patch-clamp electrophysiology or fluorescence-based assays .

Challenges and Considerations

  • Species-Specific Differences: Rat Kcna3 may exhibit divergent pharmacological profiles compared to human Kv1.3 .

  • Functional Validation: Requires rigorous electrophysiological characterization to confirm activity post-purification .

  • Commercial Availability: Limited suppliers offer recombinant Rat Kcna3, necessitating custom production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcna3; Potassium voltage-gated channel subfamily A member 3; RCK3; RGK5; Voltage-gated potassium channel subunit Kv1.3; Voltage-gated potassium channel subunit Kv3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTVVPGDHLLEPEAAGGGGGDPPQGGCVSGGGCDRYEPLPPALPAAGEQDCCGERVVINI SGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIR RPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS GPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGASSGASS FSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAER QGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVI LFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVL TIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYM VIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Uniprot No.

Target Background

Function
This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. It exists in open or closed conformations in response to transmembrane voltage differences, forming a potassium-selective channel that allows potassium ion passage according to their electrochemical gradient.
Gene References Into Functions
  1. The high stability, bioavailability, low normal-tissue uptake, and in vitro and in vivo accumulation in Kv channel up-regulated regions of [(64)Cu]Cu-NOTA-HsTX1[R14A] highlight its potential as a lead compound for treating conditions responsive to Kv1.3 voltage-gated potassium channel blockade. PMID: 28623364
  2. Antigen exposure may irreversibly alter T-cell dependence on Kv1.3 or KCa3.1. PMID: 28248292
  3. PKC activation down-regulates Kv1.3 via clathrin-mediated endocytosis, targeting the channel to lysosomal degradation. PMID: 28186199
  4. Kv1.3 is a potential therapeutic target for multiple sclerosis; its inhibition suppresses astrocyte activation in inflammatory conditions. PMID: 29574670
  5. Kv1.3 is implicated in methamphetamine-induced microglial damage. PMID: 24533129
  6. Scorpion venom peptides engineered for enhanced potency, selectivity, and half-life are being developed to target the Kv1.3 ion channel. PMID: 24939846
  7. Kv1.3 exhibits cis-Golgi membrane localization in rat astrocytes, similar to Golgi resident proteins. PMID: 24924920
  8. Voltage-gated Kv1.3 potassium channels are potential therapeutic targets for allergic asthma. PMID: 24644290
  9. The Kv1.3 C-terminal signal sequence is crucial for anterograde trafficking and surface expression. PMID: 24144698
  10. Free-energy simulations and experimental data identified a potent and selective peptide blocker of the Kv1.3 channel. PMID: 24244345
  11. Lymphocytes from spontaneously hypertensive rats (SHR) exhibit significantly elevated Kv1.3 protein expression compared to normotensive Wistar rats. PMID: 20717640
  12. A novel peptide targeting the Kv1.3 channel selectively inhibits CCR7(-) effector memory T cell activation in a rat experimental autoimmune encephalomyelitis model. PMID: 22761436
  13. Kv1.3 possesses two N-glycosylation consensus sites (N228NS and N229ST) on the S1-S2 linker, with N-glycan predominantly attached to N229. PMID: 22613618
  14. Rat brain endothelial cells express Kv1.3, Kir2.1, and Kir2.2 K+ channels, contributing to membrane potential and K+ secretion into the brain interstitial fluid. PMID: 18026984
  15. Kv1.3 regulates the duration of action potentials in C-fiber presynaptic terminals, limiting neurotransmitter release. PMID: 21430270
  16. K+ channel modulators may have therapeutic applications in activating endogenous neural progenitor cells due to Kv1.3's role in cell cycle regulation. PMID: 17029597
  17. Renal Kv1.3 channels are involved in K+ secretion, and dietary K+ loading enhances their apical membrane localization in intercalated cells. PMID: 20427469
  18. Kv1.3 potassium channels contribute to cell-autonomous death of retinal ganglion cells through apoptotic mechanisms. PMID: 19696788
  19. KCNE4, but not KCNE2, functions as an inhibitory Kv1.3 partner in leukocytes. PMID: 19773357
  20. Neurotrophin modulation of Kv1.3 channels via TrkB receptors is time- and sensory experience-dependent. PMID: 12122142
  21. Kv1.3 subunit expression is prominent in rat prostate cancer cell lines. PMID: 12838421
  22. The KCNE4 β-subunit strongly inhibits currents generated by Kv1.1 and Kv1.3 potassium channels. PMID: 12944270
  23. Activated microglia induce postnatal hippocampal neuron death through a mechanism requiring Kv1.3 channel activity in microglia, but not neurons. PMID: 16079396
  24. T cells from patients, or autoreactive T cells from healthy individuals, express low Kv1.3 levels and are primarily naive or central memory (TCM) cells. PMID: 17088564
  25. Kv1.3/Kv1.5 heteromer trafficking and localization are implicated in the complex regulation of immune system cells. PMID: 18218624
  26. Kv1.3 affects postganglionic sympathetic neuron function, suggesting its influence on sympathetic cardiovascular control. PMID: 18614767
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.3/KCNA3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the molecular structure and basic characteristics of rat Kcna3 (Kv1.3) potassium channel?

    Kcna3, also known as Kv1.3, is a voltage-gated potassium channel of the shaker-related subfamily. It contains six membrane-spanning domains with a shaker-type repeat in the fourth segment that serves as the primary voltage-sensing component . The molecular weight of rat Kv1.3 is approximately 70 kDa , though this can vary depending on post-translational modifications.

    The channel's structure includes:

    • A voltage-sensing domain (VSD) formed by segments S1-S4

    • A pore-gate domain (PD) formed by segments S5-S6 and the intervening pore loops

    • A cytoplasmic C-terminus important for channel regulation and protein interactions

    Functionally, Kv1.3 belongs to the delayed rectifier class of potassium channels that efficiently repolarize the cell membrane following an action potential .

  • Where is Kcna3 expressed in rats and how does its expression pattern compare to humans?

    In rats, Kv1.3 is primarily expressed in:

    • Brain tissue, including cerebellar regions

    • T lymphocytes and other immune cells

    • Inner mitochondrial membranes of certain cells

    Human KCNA3 shows a similar expression pattern but with some distinctions. While both species express the channel in brain and immune tissues, the human KCNA3 gene has two alternative start ATG codons (corresponding to M1 and M53), with the shortened transcript encoding a truncated but fully functional K+ channel (ΔKv1.3) .

    The human variant shows particularly high expression in T lymphocytes where it plays crucial roles in immune cell activation . Unlike some other voltage-gated channels, Kcna3 exhibits relatively low cardiac expression in both species .

  • What experimental methods are most suitable for detecting native Kcna3 in rat tissue samples?

    Based on validated research approaches, the following methods are most effective for detecting rat Kcna3:

    TechniqueRecommended DilutionValidated ApplicationsCitation
    Western Blot (WB)1:500-1:2000Rat brain tissue, thymus tissue
    Immunohistochemistry (IHC)1:500Rat brain tissue
    Immunocytochemistry (ICC)1:100Rat neurons, immune cells
    Immunofluorescence (IF-P)1:50-1:500Rat brain tissue
    ELISAPer kit instructionsTissue homogenates, cell lysates

    When using antibodies, those targeting the C-terminal domain (such as amino acids 485-506 of rat Kv1.3) have shown high specificity . For optimal results, it's recommended to use antibodies validated in knockout models to ensure specificity .

Advanced Research Applications

  • What are the key electrophysiological properties of recombinant rat Kcna3 channels and how do they differ from human Kv1.3?

    Recombinant rat Kcna3 channels exhibit distinct electrophysiological properties:

    • Activation: Voltage-dependent activation with depolarization-dependent gating

    • Inactivation: Shows C-type inactivation, though less pronounced than human Kv1.3

    • Conductance: Approximately 10-12 pS in physiological K+ conditions

    • Pharmacology: Sensitive to 4-aminopyridine (4-AP) and specific peptide toxins like hongotoxin

    Compared to human Kv1.3, rat channels show approximately 85% sequence homology, with slight differences in:

    • Voltage dependence of activation (rat channels activate at slightly more depolarized potentials)

    • Inactivation kinetics (rat channels typically inactivate somewhat slower)

    • Pharmacological sensitivity to certain blockers

    These differences are important to consider when translating findings between species or designing therapeutic strategies .

  • How can researchers effectively produce and purify recombinant rat Kcna3 protein for experimental applications?

    Several expression systems have been validated for producing functional recombinant rat Kcna3:

    1. Mammalian cell expression (HEK293, CHO cells):

      • Advantages: Proper folding, post-translational modifications

      • Protocol: Transfection of Kcna3 cDNA in expression vectors (e.g., pcDNA3.1)

      • Yield: Moderate (0.5-2 mg/L culture)

    2. Tetrahymena thermophila expression system:

      • Advantages: High-level expression, proper membrane protein folding

      • Demonstrated success for VGICs including Kv1.3

      • Superior for generating material for antibody production

    3. E. coli expression (for protein fragments):

      • Suitable for cytoplasmic domains (e.g., C-terminus)

      • Used successfully for producing immunogens

    Purification typically involves:

    • Detergent solubilization (e.g., n-dodecyl-β-D-maltoside)

    • Affinity chromatography (using His-tags or specific antibodies)

    • Size exclusion chromatography for final purification

    For functional studies, reconstitution into lipid bilayers or proteoliposomes may be required to maintain native channel conformation .

  • What strategies exist for selectively modulating Kcna3 function in experimental settings?

    Several approaches have been validated for selective modulation of Kcna3:

    Pharmacological approaches:

    • Peptide toxins: Hongotoxin (shown in fluorescent binding assays)

    • Small molecules: Fluoxetine inhibits Kv1.3 currents with similar potency in wild-type and some gain-of-function variants

    Genetic approaches:

    • CRISPR/Cas9-mediated knockout or knockin

    • Expression of dominant-negative Kcna3 variants

    • S4-S5 split channels: Breaking the covalent continuity of the S4-S5 linker creates channels with altered voltage sensing and permeation properties

    Immunological approaches:

    • Monoclonal antibodies: Several have been developed that specifically inhibit Kv1.3 current with IC50 values <10 nM

    • Recombinant antibodies: Anti-Kv1.3 K+ channel antibodies (e.g., L23/27) can be used for both detection and modulation

Technical Considerations

  • What challenges exist in developing specific antibodies against rat Kcna3 and how can they be overcome?

    Developing specific antibodies against rat Kcna3 presents several challenges:

    • High sequence conservation: Sequence similarity among Kv1 family members makes specificity difficult

    • Conformational epitopes: Native channel structure contains conformational epitopes that may be lost in denatured proteins

    • Limited accessibility: Some important domains are not accessible in the folded channel

    Successful strategies to overcome these challenges include:

    1. Target selection:

      • C-terminal epitopes (amino acids 485-506) have yielded specific antibodies

      • Synthetic peptides corresponding to unique regions of the Kv1.3 sequence

    2. Multiplatform approach:

      • High-level expression in Tetrahymena thermophila

      • Immunization of phylogenetically diverse species (chickens, llamas)

      • Specialized screening tools for antibodies binding functionally important regions

    3. Validation methods:

      • Western blot on rat whole brain lysate

      • Cross-reactivity testing against related channels (especially Kv1.2, Kv1.4)

      • Knockout validation to confirm specificity

    Using this approach, researchers have successfully generated specific monoclonal antibodies like L23/27, which targets the cytoplasmic C-terminus of rat Kv1.3 .

  • What are the key experimental considerations when performing electrophysiological studies on recombinant rat Kcna3 channels?

    Electrophysiological characterization of rat Kcna3 requires attention to several experimental parameters:

    Expression systems:

    • HEK293 or CHO cells provide reliable expression for patch-clamp studies

    • Xenopus oocytes work well for two-electrode voltage clamp measurements

    • Note that different expression systems can yield subtly different channel properties

    Recording conditions:

    • Physiological K+ concentrations (5-6 mM external, 140-150 mM internal)

    • Temperature control (rat Kcna3 properties are temperature-sensitive)

    • pH stability (7.2-7.4 for most physiological studies)

    Protocols for characteristic measurements:

    • Activation: Voltage steps from -80 mV to +40 mV in 10 mV increments

    • Inactivation: Prolonged depolarizations (>1s) to assess C-type inactivation

    • Deactivation: Tail currents following activating pulses

    • Use-dependence: Repetitive pulsing protocols at various frequencies

    Common pitfalls:

    • Contamination by endogenous channels (use specific blockers to isolate Kv1.3 currents)

    • Rundown during prolonged recordings (supplement ATP in internal solution)

    • Access resistance changes (monitor continuously and compensate)

    • Heteromultimerization with endogenous Kv subunits (consider heterologous systems with minimal Kv expression)

  • How does the non-domain-swapped architecture of Kcna3 channels differ from classical Kv channels, and what are the implications for research?

    Recent structural studies have revealed that Kcna3, as part of the EAG channel family, exhibits a non-domain-swapped architecture that differs significantly from classical Kv channels:

    Architectural differences:

    • In classical Kv channels (Shaker-type), the voltage-sensing domain (VSD) of one subunit interacts with the pore domain (PD) of the neighboring subunit (domain-swapped)

    • In Kcna3/EAG channels, each VSD interacts with the PD of the same subunit (non-domain-swapped)

    Mechanistic implications:

    • Gating mechanism: The S4-S5 linker in domain-swapped channels acts as a mechanical lever, but this mechanism differs in non-domain-swapped channels

    • This is demonstrated by functional S4-S5 split channels where the covalent continuity of the S4-S5 linker is broken

    Research considerations:

    • Traditional models of voltage-dependent gating may not apply directly to Kcna3

    • Allosteric influences from cytoplasmic domains may play larger roles in channel gating

    • Drug binding sites and conformational changes during gating may differ significantly

    • Interpretation of structure-function studies needs to account for these architectural differences

    This architectural distinction explains why some modulators affect Kcna3 differently than other Kv channels and has significant implications for rational drug design targeting these channels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.