Recombinant Rat Potassium voltage-gated channel subfamily A member 5 (Kcna5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Kcna5; Potassium voltage-gated channel subfamily A member 5; RCK7; RK4; Voltage-gated potassium channel subunit Kv1.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcna5
Target Protein Sequence
MEISLVPLENGSAMTLRGGGEAGASCVQTPRGECGCPPTSGLNNQSKETLLRGRTTLEDA NQGGRPLPPMAQELPQPRRLSAEDEEGEGDPGLGTVEEDQAPQDAGSLHHQRVLINISGL RFETQLGTLAQFPNTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGINGSVSGALSSG PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYF ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM RELGLLIFFLFIGVILFSSAVYFAEADNHGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGNQRRESGLDTG GQRKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET DL
Uniprot No.

Target Background

Function

Voltage-gated potassium channel mediating transmembrane potassium transport in excitable membranes. It forms tetrameric potassium-selective channels, facilitating potassium ion passage according to their electrochemical gradient. The channel's conformation dynamically shifts between open and closed states in response to transmembrane voltage differences. It can form functional homotetrameric and heterotetrameric channels with varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, and potentially other family members, influencing channel properties. Cytoplasmic beta subunits modulate channel properties, regulating alpha subunit subcellular localization and promoting rapid inactivation. Homotetrameric channels exhibit rapid activation and slow inactivation. This channel may also play a role in regulating insulin secretion in healthy pancreatic islets.

Gene References Into Functions
  1. Ang II selectively stimulates KV1.5 channel degradation, reducing functional surface abundance in mesenteric artery myocytes. PMID: 27958660
  2. Ang II upregulates Kv1.5, SAP97, and TGF-β1 expression in neonatal rat atrial myocytes. PMID: 25451261
  3. AMPK selectively inhibits Kv1.5 in pulmonary arterial myocytes. PMID: 27062501
  4. Altered NFATc2 and KV1.5 gene and protein expression is observed in the pulmonary vasculature of nitrofen-induced congenital diaphragmatic hernia. NFATc2 upregulation with concomitant Kv1.5 downregulation may contribute to abnormal vascular remodeling. PMID: 27522126
  5. H2S downregulates Ang II-induced atrial Kv1.5 expression by attenuating Nox4-related ROS-triggered P-Smad2/3 and P-ERK 1/2 activation during atrial fibrillation. PMID: 28011270
  6. Intravascular pressure-induced membrane depolarization selectively increased voltage-dependent potassium channels K(v)1.5 surface abundance, increasing K(v) currents in arterial myocytes and limiting vasoconstriction. PMID: 26286025
  7. KV1.5, a DPO-1-sensitive KDR channel, plays a significant role in determining microvascular tone and the response to vasoconstrictors and vasodilators. PMID: 25808400
  8. Inhibited Kv1.5 expression in pulmonary artery smooth muscle cells contributes to exaggerated chronic hypoxia pulmonary hypertension in intrauterine growth retardation rats during adulthood. PMID: 24077947
  9. Kv1.5 may play a significant role in oxidative vascular endothelial injury. PMID: 23185428
  10. Puerarin upregulated Kv1.5 expression, decreased proliferation, and increased hypoxia-induced apoptosis in pulmonary artery smooth muscle cells. PMID: 22357486
  11. Immunocytochemistry revealed an association between K(v)1.5, K(v)β1.3, RACK1, PKCβI, PKCβII, and PKCθ. PMID: 22547057
  12. In rat bronchial smooth muscle cells, PKC activation inhibits K(V) currents and downregulates K(V)1.5 expression. PMID: 12715100
  13. BKCa and KV channels limit conducted vasomotor responses in rat mesenteric terminal arterioles. PMID: 22052159
  14. Augmenter of liver regeneration may increase HIF-1α and K(+) channel expression and decrease intracellular free Ca(2+), inhibiting arterial contraction and promoting kidney perfusion post-OLT. PMID: 21365420
  15. Kv1.5 and Kv2.1 account for almost all O2-sensitive current in resistance pulmonary arteries. PMID: 15217912
  16. A pathway for Kv1.5 internalization involves early endosomes and subsequent dynein motor-mediated trafficking along microtubules. PMID: 16051887
  17. Kv1.5 overexpression induces short action potential duration and triggers activity in rat cardiomyocytes. PMID: 16713996
  18. Heterogeneous function and expression of Kv1 alpha-subunits are observed in rat coronary myocytes from RCA or LCA. PMID: 16731637
  19. Kv1.5 is absent in rat and canine heart caveolae. PMID: 17054951
  20. Kv1.5 subunits concentrate in cholesterol-enriched membrane microdomains distinct from caveolae. PMID: 17525113
  21. Pulmonary artery smooth muscle cell heterogeneity may partly stem from varying Kv channel expression levels and functional hypoxia sensitivity. PMID: 17526598
  22. Generalized NFAT inhibition by cyclosporine upregulates Kv1.5 in isolated pulmonary artery in vivo and reverses established rat pulmonary hypertension. PMID: 17596340
  23. Kcna5 promoter activity in vascular smooth muscle critically depends on Sp1 regulation via CACCC box motifs. PMID: 17660393
  24. Caveolin regulates Kv1.5 trafficking to cholesterol-rich membrane microdomains. PMID: 18045854
  25. Inhibited K(v) channel expression and increased [Ca(2+)](i) during chronic hypoxia may result from HIF-1-dependent ET-1 induction. PMID: 18065659
  26. Hypoxia inhibits K(V)1.5 channels via the 15-lipoxygenase/15-HETE pathway. PMID: 18984061
  27. Cholesterol regulates Kv1.5 channel expression by modulating its trafficking through the Rab11-associated recycling endosome. PMID: 19706553
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.5/KCNA5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed equally in atrium, ventricle, aorta and skeletal muscle. Weaker expression in brain.

Q&A

What is the functional significance of Kcna5 in cardiac electrophysiology?

Kcna5 (Kv1.5) is a key determinant of the atrial action potential, conducting the ultra-rapidly activating delayed rectifier potassium current (IKur). In research contexts, Kcna5 plays a critical role in determining action potential duration and repolarization in atrial myocytes . Methodologically, this makes Kcna5 an important target for studying cardiac arrhythmias, particularly atrial fibrillation.

When designing experiments to investigate Kcna5 function, researchers should:

  • Incorporate appropriate physiological conditions that mimic native cellular environments

  • Account for potential species differences between rat Kcna5 and human KCNA5

  • Consider the impact of channel phosphorylation states on function

  • Evaluate channel kinetics under various voltage protocols to fully characterize the current

What expression systems are optimal for studying recombinant rat Kcna5?

The choice of expression system significantly impacts the functional characteristics of recombinant Kcna5. Chinese hamster ovary (CHO) cells represent an excellent model for Kcna5 expression as they lack endogenous outward currents that might contaminate electrophysiological recordings . For methodological implementation:

  • Transiently transfect CHO cells with rat Kcna5 cDNA using appropriate vectors (e.g., pBK/CMV vector with pIRES-GFP for visual identification of transfected cells)

  • Optimize transfection parameters: For FuGENE6-mediated transfection, a ratio of 2 μg cDNA to 12 μL transfection reagent has been shown to provide efficient expression

  • Allow 24-48 hours post-transfection for optimal channel expression

  • Select successfully transfected cells using fluorescent markers (e.g., GFP) for electrophysiological studies

Alternative expression systems include Xenopus oocytes for two-electrode voltage clamp studies and HEK293 cells, though each system presents different advantages and limitations for channel characterization.

How should electrophysiological solutions be optimized for Kcna5 recordings?

Proper solution composition is critical for accurate Kcna5 current recordings. For whole-cell patch-clamp experiments, researchers should utilize:

Internal (pipette) solution:

  • KCl: 110 mM

  • K4BAPTA: 5 mM (for calcium buffering)

  • K2ATP: 5 mM (to prevent channel rundown)

  • MgCl2: 1 mM

  • HEPES: 10 mM

  • pH adjusted to 7.2 with KOH (resulting in ~145 mM final K+ concentration)

External (bath) solution:

  • NaCl: 130 mM

  • KCl: 4 mM

  • CaCl2: 1.8 mM

  • MgCl2: 1 mM

  • HEPES: 10 mM

  • Glucose: 10 mM

  • pH adjusted to 7.35 with NaOH

These solutions maintain physiological ionic gradients while providing stable recording conditions. When investigating specific channel properties, modifications may be necessary, such as altered K+ concentrations to examine ion selectivity or addition of specific blockers to isolate Kcna5 currents.

What voltage-clamp protocols are most informative for characterizing rat Kcna5 biophysical properties?

Comprehensive characterization of Kcna5 requires multiple voltage protocols to analyze distinct channel properties:

  • Activation protocol: Hold at -80 mV and apply 500 ms depolarizing pulses from -40 to +60 mV in 10 mV increments, followed by a repolarizing step to -40 mV to record tail currents . This protocol enables:

    • Construction of I-V relationships

    • Determination of activation threshold

    • Calculation of voltage-dependent activation parameters (V₁/₂ and slope factor) using Boltzmann fitting: I = Imax/{1 + exp[(Vt − V₁/₂)/k]}

    • Measurement of activation kinetics through exponential fitting

  • Deactivation protocol: Depolarize to +50 mV to fully activate channels, then apply variable repolarizing steps to measure tail current decay

  • Inactivation protocol: Apply long (5-10 s) conditioning pulses at various voltages followed by a test pulse to assess voltage-dependent inactivation

  • Drug response monitoring: Apply repetitive 500 ms pulses to +50 mV from a holding potential of -80 mV at 5 kHz frequency to continuously monitor channel activity during drug application

These protocols should be delivered with sufficient inter-pulse intervals (15-20 seconds) to ensure complete recovery between stimulations .

How can researchers accurately assess drug interactions with Kcna5?

When investigating drug modulation of Kcna5, several methodological considerations are essential:

  • Equilibration time: Allow sufficient time for drug-channel interaction, typically monitoring current until a steady-state block is achieved

  • Wash-out assessment: Implement extended wash-out periods to distinguish between reversible and persistent inhibition

  • Recovery protocols: Design protocols with variable inter-pulse intervals (1-20 seconds) to assess time-dependent recovery from block

  • Concentration-response relationships: Test multiple drug concentrations (e.g., 1, 3, 10, and 30 μM) to establish IC₅₀ values and compare potency across conditions

  • Control for drug uptake/efflux: Consider the influence of drug transporters (e.g., OCTN1, MDR1) that may affect intracellular drug concentrations when expressed in the same cells as Kcna5

For accurate data interpretation, normalize current inhibition to pre-drug baseline and construct concentration-response curves using appropriate non-linear regression models.

What approaches can differentiate between direct channel block and altered trafficking of Kcna5?

Distinguishing between direct channel inhibition and altered membrane trafficking is crucial for understanding drug mechanisms and disease pathophysiology:

  • Real-time trafficking assessment:

    • Utilize Kcna5 constructs with pH-sensitive GFP tags to monitor surface expression dynamically

    • Implement TIRF microscopy to visualize channel insertion/retrieval at the membrane

  • Biochemical approaches:

    • Surface biotinylation assays to quantify membrane-expressed channels

    • Western blotting of membrane fractions versus total cellular protein

    • Pulse-chase experiments to track protein maturation and degradation

  • Electrophysiological approaches:

    • Compare the time course of drug effects (rapid onset suggests direct block)

    • Assess voltage-dependence of inhibition (often indicative of direct pore block)

    • Examine kinetic changes in activation/deactivation with channel modulators

  • Genetic manipulation:

    • Introduce trafficking-deficient mutations as positive controls

    • Co-express with channel auxiliary subunits that may affect surface expression

These complementary approaches provide a comprehensive assessment of whether observed functional changes result from direct channel modulation or altered membrane expression.

How does Kcna5 contribute to pulmonary arterial hypertension models?

Kcna5 plays a significant role in pulmonary vascular function, and its dysregulation contributes to pulmonary arterial hypertension (PAH). Methodological approaches to investigate this relationship include:

  • Animal models:

    • Chronic hypoxia-induced PAH in rats with Kcna5 expression/function assessment

    • Monocrotaline-induced PAH with pulmonary vascular Kcna5 characterization

  • Cellular mechanisms:

    • Downregulation of KCNA5 gene expression contributes to increased vascular tone in PAH

    • Increased tyrosine-phosphorylation of Kcna5 channels leads to proliferation of pulmonary artery smooth muscle cells and pulmonary arterial wall thickening

  • Experimental techniques:

    • Pressure myography to assess pulmonary arterial reactivity

    • Chronic in vivo Kcna5 modulation using viral vectors

    • Assessment of channel expression and phosphorylation status in different vascular beds

For translational relevance, researchers should correlate findings in rat models with human PAH samples, noting the 17 single-nucleotide polymorphisms identified in the Kv1.5 gene in PAH patients .

What is the relationship between Kcna5 and atrial fibrillation?

As a key contributor to atrial repolarization, Kcna5 (Kv1.5) represents an important therapeutic target for atrial fibrillation (AF). Research methodologies should address:

  • Expression analysis in AF models:

    • Quantify channel protein and mRNA in chronic AF versus control tissues

    • Assess post-translational modifications that may alter channel function

  • Functional studies:

    • Compare IKur current densities and kinetics in atrial myocytes from normal and AF models

    • Evaluate the impact of Kcna5 inhibitors on action potential duration and effective refractory period

  • Peptide inhibitor development:

    • Design rationally modified peptide sequences targeting Kcna5 guided by in silico docking experiments

    • Evaluate peptide selectivity for Kcna5 versus other cardiac potassium channels

    • Assess efficacy in converting or preventing AF in appropriate models

When designing therapeutic studies, researchers should consider atrial selectivity of Kcna5 modulators to minimize ventricular effects and proarrhythmic potential.

How can researchers address challenges in recording stable Kcna5 currents?

Maintaining stable Kcna5 recordings presents several technical challenges that can be addressed through methodological refinements:

  • Preventing current rundown:

    • Include ATP (5 mM) in the internal solution to maintain channel phosphorylation

    • Add phosphatase inhibitors to prevent dephosphorylation-dependent current decline

    • Minimize calcium-dependent inactivation by including appropriate calcium buffers (e.g., 5 mM BAPTA)

  • Optimizing seal formation and stability:

    • Prepare cells with gentle enzymatic dissociation to preserve membrane integrity

    • Fire-polish patch pipettes to improve seal formation and stability

    • Maintain consistent pipette resistance (2-4 MΩ) for reproducible recordings

  • Signal quality enhancement:

    • Filter whole-cell currents at 5 kHz and acquire at 1-2 kHz for optimal signal-to-noise ratio

    • Compensate for series resistance to minimize voltage errors

    • Perform recordings at controlled temperature (22-23°C) to reduce thermal noise

  • Addressing expression variability:

    • Standardize post-transfection recording times (24-48 hours)

    • Express data as current density (pA/pF) to normalize for cell size differences

    • Use fluorescent markers to identify cells with similar expression levels

What strategies can improve the specificity of pharmacological studies on Kcna5?

When conducting pharmacological investigations of Kcna5, several methodological approaches can enhance specificity:

  • Control for transporter effects:

    • Consider co-expression of drug transporters (OCTN1, MDR1) that may affect intracellular drug concentrations

    • Include transporter inhibitors (e.g., cimetidine for OCTN1, reversin-205 for MDR1) as controls to isolate direct channel effects

    • Compare IC₅₀ values in the presence and absence of transporters to quantify their impact

  • Distinguish binding sites:

    • Use site-directed mutagenesis of known drug binding residues

    • Compare drugs acting on the inner pore versus outer mouth of the channel

    • Implement state-dependent protocols to identify preferential binding to open, closed, or inactivated states

  • Ensure compound purity and stability:

    • Verify drug purity through analytical methods before experiments

    • Prepare fresh stock solutions and working dilutions to prevent degradation

    • Control for vehicle effects, especially with poorly soluble compounds

  • Implement appropriate controls:

    • Include positive controls (known Kcna5 blockers) to validate experimental conditions

    • Use negative controls (non-Kcna5 targeting compounds) to confirm specificity

    • Test multiple structurally diverse compounds targeting the same site

How should researchers quantitatively analyze Kcna5 gating kinetics?

Rigorous analysis of Kcna5 gating requires sophisticated quantitative approaches:

  • Activation kinetics:

    • Fit the rising phase of currents with single or double exponential functions to extract time constants (τ)

    • Plot activation time constants versus voltage to examine voltage-dependence of activation

    • Construct energy barrier models to interpret kinetic data mechanistically

  • Deactivation analysis:

    • Analyze tail currents with exponential fitting to determine deactivation rates

    • Account for the influence of driving force on apparent kinetics

    • Implement envelope of tails protocols to separate multiple kinetic components

  • Voltage-dependence quantification:

    • Derive activation curves from normalized tail currents or conductance calculations

    • Fit with Boltzmann function to determine V₁/₂ and slope factor (k)

    • Calculate the effective gating charge from the slope factor: z = 25.69/k at room temperature

  • State-dependent modeling:

    • Develop Markov models incorporating closed, open, and inactivated states

    • Fit experimental data to extract rate constants between states

    • Simulate channel behavior under novel conditions to generate testable hypotheses

The parameter values obtained (e.g., V₁/₂ = -12.9 ± 1.6 mV for KCNA5) provide important quantitative measures for comparing experimental conditions or disease states.

What are the current standards for analyzing protein-protein interactions involving Kcna5?

Understanding Kcna5 regulation requires characterization of its protein interaction network:

  • Co-immunoprecipitation approaches:

    • Use specific antibodies against Kcna5 to pull down associated proteins

    • Implement crosslinking strategies to capture transient interactions

    • Perform reciprocal co-IPs to confirm specificity of interactions

  • Proximity labeling techniques:

    • Express Kcna5 fused to BioID or APEX2 proximity labeling enzymes

    • Identify proximal proteins through mass spectrometry analysis

    • Validate candidate interactions through orthogonal methods

  • Functional validation:

    • Assess the impact of co-expression on channel properties

    • Screen for associated proteins that modify Kcna5 trafficking or function

    • Evaluate interactions with signaling molecules, especially Src family protein tyrosine kinases that link Kcna5 to proliferation pathways

  • Structural approaches:

    • Implement FRET/BRET to measure proximity between Kcna5 and interacting proteins

    • Use cryo-EM to determine structures of channel complexes

    • Perform molecular docking to predict interaction interfaces

Each method provides complementary information about the Kcna5 interactome, helping to elucidate its role in signaling pathways and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.