Recombinant Rat Potassium voltage-gated channel subfamily C member 1 (Kcnc1)
Shipped with Ice Packs 
In Stock 
Description
Introduction to Recombinant Rat Kcnc1
Recombinant Rat Kcnc1 is a laboratory-produced version of the voltage-gated potassium channel Kv3.1, encoded by the Kcnc1 gene. It facilitates high-frequency action potentials in fast-spiking neurons and is essential for regulating neuronal excitability . Recombinant expression enables biochemical, structural, and functional studies without requiring native tissue extraction .
Production and Purification
Recombinant Rat Kcnc1 is produced using multiple expression systems:
Mammalian systems (e.g., HEK293) are preferred for proper glycosylation and membrane localization .
Functional Role in Neuronal Systems
Kcnc1 channels enable rapid repolarization of action potentials in fast-spiking GABAergic interneurons and auditory neurons . Key functional attributes include:
-
Voltage Sensitivity: Activates at depolarized potentials (~−20 mV) .
-
Kinetics: Ultra-rapid activation and deactivation, supporting high-frequency firing .
-
Pathway Involvement:
Research Applications
Recombinant Rat Kcnc1 is utilized in:
-
Electrophysiology: Patch-clamp studies to characterize current density and kinetics .
-
Disease Modeling: Investigating developmental epileptic encephalopathies caused by Kcnc1 variants .
-
Drug Screening: Identifying modulators of Kv3.1 for neurological disorders .
Biochemical Properties
Key Research Findings
-
Trafficking Deficits: The A421V variant reduces membrane localization by ~50%, impairing neuronal excitability .
-
Epilepsy Link: Heterozygous Kcnc1 mutations cause progressive myoclonic epilepsy via disrupted inhibitory neurotransmission .
-
Therapeutic Targets: Kv3.1 enhancers (e.g., AUT1) are under investigation for myoclonus and ataxia .
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will prepare the protein according to your request.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please contact your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Kcnc1; Potassium voltage-gated channel subfamily C member 1; NGK2; RAW2; Voltage-gated potassium channel subunit Kv3.1; Voltage-gated potassium channel subunit Kv4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnc1
Target Protein Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTR
ERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT
Uniprot No.
Target Background
Function
Voltage-gated potassium channel, crucial for rapid repolarization of fast-firing brain neurons. This channel activates upon changes in membrane potential, creating a potassium-selective pore facilitating potassium ion movement down their electrochemical gradient. It forms functional homotetrameric and heterotetrameric channels, potentially incorporating variable proportions of KCNC2 and other family members. This channel contributes to the sustained firing of high-frequency, brief action potentials in pallidal neurons.
Gene References Into Functions
- Trafficking-dependent functions of the Kv3.1b potassium channel rely on N229 site-specific glycosylation and N-glycan structure, influencing cell surface expression through a mechanism where specific N-glycan structures regulate expression. PMID: 28322444
- This study demonstrated the expression of Kv3.1b potassium channel in motor cortex pyramidal cells. PMID: 28213922
- Our findings provide direct evidence that N-glycans of Kv3.1 splice variants contribute to their localization in the plasma membrane of neuronal-derived cells, whereas those of Kv1.1 were absent. PMID: 26348848
- Results indicate that Src kinase plays a significant role in regulating membrane trafficking of Kv3.1b channels. PMID: 24291260
- High-affinity multimeric binding between the Kv3.1 T1 domain and KIF5B requires three basic residues in the KIF5B tail. Kv3.1 T1 competes with the motor domain and microtubules, but not with kinesin light chain 1 (KLC1), for binding to the KIF5B tail. PMID: 23487040
- The unique N-terminus of DPP6K modulates the effects of KChIP proteins, slowing recovery and producing a negative shift in the steady-state inactivation curve. PMID: 22675523
- Alternative splicing regulates neuronal firing rates by controlling the polarized targeting of Kv3.1 channels. PMID: 22105078
- These results have demonstrated that N-glycans of the Kv3.1 glycoprotein enhance outward ionic current kinetics and neuronal migration. PMID: 21541302
- This study aimed to elucidate the relative distribution of Kv3.1b and Kv3.3 in specific compartments of the parallel fibers in the cerebellar cortex PMID: 20857303
- A previously unknown interaction between the KV4 channel and Kv channel interacting protein (KChIP)3 in Muller cells could exert a physiological role in the onset of diabetic retinopathy. PMID: 21147063
- Net amounts of Kv3.1b protein can change on a time scale of minutes in response to stimulus-driven synaptic activity, allowing auditory neurons to actively adapt their complement of ion channels to changes in the acoustic environment. PMID: 20219640
- Kv3-like currents may be crucial for maintaining spike width and calcium influx within acceptable limits during repetitive firing. PMID: 15240761
- Synaptic inputs evoked by stimulation of a region lacking Kv3.1b-IR neurons were not affected, correlating the presence of Kv3.1b in the tractus solitarius with the pharmacological effects. [Kv3.1b] PMID: 15528247
- Both fast-firing and burst-firing parvalbumin+ interneurons in the basolateral amygdala express the Kv3.1b subunit. PMID: 16413129
- The Kv3.1b channel is regulated by both conventional and novel PKC isozymes, with novel PKC-delta specifically contributing to the maintenance of basal phosphorylation in auditory neurons PMID: 16595659
- The axon-dendrite targeting of Kv3.1 Shaw channel is controlled by a conditional interaction of a C-terminal axonal targeting motif with the N-terminal T1 domain and adaptor protein ankyrin G. PMID: 18094255
- It is suggested that fluoxetine acts as an open-channel blocker on Kv3.1 currents. PMID: 18187934
- The results suggest that altered expression of Kv3 channels affects the functional properties of FS neurons and may contribute to the deficits in inhibition observed in the sensory-deprived cortex. PMID: 18708127
- Report on the effect of psoralen on the cloned Kv3.1 currents. PMID: 19387585
Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.1/KCNC1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell junction, synapse, presynaptic cell membrane.
Tissue Specificity
Expressed in brain. Expressed in globus pallidal neurons of the basal ganglia (at protein level). Detected on Purkinje cells in the cerebellum molecular layer (at protein level).
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
