Recombinant Rat Potassium voltage-gated channel subfamily C member 2 (Kcnc2)

Shipped with Ice Packs
In Stock

Description

Functional and Pharmacological Properties

KCNC2 channels are characterized by their voltage-dependent activation at high thresholds and slow inactivation, enabling sustained high-frequency firing in neurons . Recombinant Kcnc2 retains these properties, making it a model for studying channel gating and modulation.

2.1. Electrophysiological Characteristics

  • Activation: Rapid activation at depolarized voltages (e.g., >0 mV)

  • Inactivation: Slow, voltage-dependent closure

  • Sensitivity: Blocked by tetraethylammonium (TEA, IC₅₀ ~0.1 mM) and 4-aminopyridine (4-AP)

ModulatorEffectMechanism
TEAHigh-affinity blockExtracellular pore occlusion
4-APCompetitive inhibitionAffects gating kinetics
Nitric oxide (NO)Modulates activation via cGMP-PKG pathwaySlows channel activation/deactivation

Production and Applications

Recombinant Kcnc2 is synthesized using diverse systems to optimize yield and functional integrity.

3.1. Production Methods

Host SystemAdvantagesApplications
E. coliHigh yield, cost-effectiveStructural studies, antibody production
HEK293 cellsPost-translational modificationsFunctional assays, pharmacology
Cell-free synthesisFlexibility in tag engineeringRapid protein production, purity >80%

Key Applications:

  1. Electrophysiology: Automated patch-clamp studies to assess voltage dependence and drug responses .

  2. Biochemical Analysis: SDS-PAGE, Western blot for structural validation .

  3. Functional Studies: ELISA, ligand-binding assays for channel-drug interactions .

Disease Relevance and Mutational Insights

KCNC2 mutations are linked to neurological disorders, including developmental and epileptic encephalopathy. Recombinant Kcnc2 is critical for studying these pathogenic variants.

4.1. Pathogenic Mutations

A notable mutation, p.Cys125Tyr (c.374G>A), disrupts the cytoplasmic cT1D domain, altering voltage-dependent activation. This gain-of-function mutation:

  • Mechanism: Disrupts π-π stacking interactions in the cT1D, hyperpolarizing activation voltage .

  • Outcome: Impaired excitability in GABAergic interneurons, contributing to epilepsy .

MutationDomain AffectedFunctional ImpactPhenotype
p.Cys125TyrcT1D (α-6 helix)Hyperpolarized activation, enhanced conductanceEpilepsy, interneuron dysfunction
S4 segment variantsVoltage sensorDepolarized activation, slowed kineticsAltered drug responsiveness

Research Challenges and Future Directions

While recombinant Kcnc2 has advanced functional studies, challenges persist:

  1. Heterotetramerization: KCNC2 often co-assembles with KCNC1; recombinant systems must mimic native stoichiometry .

  2. Pharmacological Heterogeneity: Variants exhibit divergent responses to drugs like retigabine, necessitating tailored therapies .

  3. Structural Dynamics: Cryo-EM and molecular dynamics are needed to resolve gating mechanisms and mutation effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Kcnc2; Potassium voltage-gated channel subfamily C member 2; Potassium channel voltage-gated Shaw-related subfamily C member 2; Shaw-like potassium channel; Voltage-gated potassium channel subunit Kv3.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnc2
Target Protein Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPP LSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGSDHPGGGREFFFDRHPGVFAYVLNYYRT GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG DDEDLGGKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFIL VSITTFCLETHEAFNIVKNKTEPVINGTSAVLQYEIETDPALTYVEGVCVVWFTFEFLVR IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY SLAMAKQKLPRKRKKHIPPAPLASSPTFCKTELNMACNSTQSDTCLGKENRLLEHNRSVL SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Uniprot No.

Target Background

Function

The voltage-gated potassium channel Kcnc2 (Kv3.2) mediates potassium ion transport across excitable cell membranes, predominantly in the brain. It plays a crucial role in regulating rapid action potential repolarization and sustained high-frequency neuronal firing in the central nervous system. As a homotetrameric channel, it facilitates delayed-rectifier potassium currents, activating rapidly at high threshold voltages and inactivating slowly. Potassium ions permeate the tetrameric channel according to their electrochemical gradient, transitioning between open and closed states in response to membrane voltage. Kcnc2 can form functional homotetramers and heterotetramers with other Kv3 subunits (e.g., KCNC1), influencing channel properties based on subunit composition. These properties can be further modulated by ancillary subunits (KCNE1, KCNE2, KCNE3) or indirectly by nitric oxide (NO) via cGMP- and PKG-mediated signaling, affecting channel activation and deactivation kinetics. Kv3.2 contributes to sustained high-frequency firing in retinal ganglion cells, thalamocortical and suprachiasmatic nucleus (SCN) neurons, and hippocampal and neocortical interneurons. Histamine H2 receptor activation negatively modulates this high-frequency firing in hippocampal interneurons through a cAMP- and PKA-dependent mechanism. In neocortical GABAergic interneurons, Kv3.2 maintains synaptic transmission fidelity by contributing to action potential repolarization at nerve terminals, reducing calcium influx and GABA release. Furthermore, Kv3.2 is involved in long-range synchronization of neocortical gamma oscillations and modulates the circadian rhythm of SCN neuronal firing in a light-dependent manner.

Gene References Into Functions
  1. In the absence of potassium ions, significant N-methyl-D-glucamine (NMDG)-positive currents were recorded from human embryonic kidney cells expressing Kv3.1 or Kv3.2b channels and Kv1.5 Arg487Tyr/Val, but not wild-type channels. PMID: 19332619
  2. Strong, selective localization of Kv3.2 was observed in cerebellar basket cell axons. PMID: 15488478
  3. The functional significance of Kv3.2 expression in certain parvalbumin+ and somatostatin+ amygdala interneurons remains undetermined. PMID: 16413129
  4. This study provides the first characterization of Kv3 gating currents and offers insights into the interaction between BDS toxins and Kv3 channels. PMID: 17855760
Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.2/KCNC2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Perikaryon. Cell projection, axon. Cell junction, synapse. Cell junction, synapse, synaptosome. Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, presynaptic cell membrane.; [Isoform 1]: Apical cell membrane.; [Isoform 2]: Apical cell membrane.; [Isoform 3]: Basolateral cell membrane.
Tissue Specificity
Expressed in neurons of the visual cortex during postnatal development. Expressed in neurons of the globus pallidus at postnatal age day 7 (P7), onward. Expressed in thalamic relay neurons. Expressed in neurons in layer IV and deeper cortical layers of th

Q&A

What is Kcnc2 and what is its functional significance in neural excitability?

Kcnc2 encodes Kv3.2, a member of the Shaw-related (Kv3) voltage-gated potassium channel subfamily. These channels play a critical role in the regulation of brain excitability by facilitating sustained high-frequency firing and optimizing energy efficiency of action potentials. Kv3.2 is primarily expressed in the interneurons of cortex, thalamus, hippocampus, and basal ganglia .

The functional significance of Kv3.2 includes:

  • Regulation of action potential duration

  • Control of neuronal firing patterns

  • Modulation of neurotransmitter release

  • Contribution to the excitability of inhibitory neurons

Kv3.2 channels are characterized by their fast activation and deactivation kinetics, which allow for rapid repolarization of action potentials, thereby permitting high-frequency neuronal firing without compromising precision .

What are the key structural domains of recombinant rat Kcnc2 and their functional implications?

Rat Kcnc2, similar to human KCNC2, contains several key structural domains that contribute to its function:

DomainLocationFunctionSignificance for Research
N-terminusCytoplasmicChannel modulation, protein-protein interactionsImportant target for regulatory processes
S1-S4 segmentsTransmembraneVoltage sensingCritical for channel gating properties
S5-S6 segmentsTransmembranePore formationDeterminants of ion selectivity and conductance
S5-S6 linkerExtracellularForms ion-selective poreCritical for ion conductance and selectivity
C-terminusCytoplasmicTrafficking, modulationImportant for channel localization and regulation

The S5-S6 linker is particularly important as it forms the ion-selective pore of the channel. Mutations in this region, such as the human R405G variant, can significantly alter channel properties and are associated with neurological disorders .

How does rat Kcnc2 expression vary across different brain regions and developmental stages?

Rat Kcnc2 shows distinct spatial and temporal expression patterns that correlate with its functional roles:

  • Brain Regions: Kv3.2 is predominantly expressed in interneurons of the cortex, thalamus, hippocampus, and basal ganglia, similar to its human ortholog .

  • Cell Types: Primarily found in fast-spiking GABAergic interneurons, where its rapid kinetics enable high-frequency firing.

  • Developmental Regulation: Expression increases during postnatal development, correlating with the maturation of inhibitory circuits.

This regional specificity makes Kcnc2 particularly relevant for research on inhibitory circuit function and neurological disorders involving disrupted excitation-inhibition balance.

What are the optimal methods for expressing and purifying recombinant rat Kcnc2 for functional studies?

Several expression systems have been validated for recombinant Kcnc2 studies, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
Xenopus oocytesLarge cells ideal for electrophysiology, Post-translational modificationsLower throughput, Temperature limitationsDetailed biophysical characterization
HEK-293 cellsMammalian processing, Higher throughputLess robust expression than oocytesPharmacological screening, Protein-protein interactions
Yeast systemsCost-effective, ScalableLimited post-translational modificationsProtein purification for structural studies
Neuronal culturesNative cellular environmentComplex background conductancesTrafficking and localization studies

For purification of rat Kcnc2:

  • Use N-terminal tags (6xHis or FLAG) for affinity purification

  • Employ mild detergents (DDM or LMNG) to maintain protein stability

  • Include phosphatase inhibitors to preserve native phosphorylation states

  • Consider size exclusion chromatography as a final purification step

These considerations ensure functional integrity of the channel for downstream applications .

What electrophysiological approaches provide the most reliable characterization of rat Kcnc2 channel properties?

Electrophysiological characterization of rat Kcnc2 requires careful selection of techniques based on research objectives:

TechniqueApplicationsKey Parameters to MeasureSpecial Considerations
Whole-cell patch clampBasic biophysical propertiesActivation/inactivation kinetics, Voltage dependenceUse series resistance compensation
Outside-out patchesSingle channel propertiesConductance, Open probabilityRequires low noise recording equipment
Automated patch clampPharmacological screeningDose-response relationshipsEnables higher throughput analysis
Current clampFiring pattern effectsAction potential waveforms, Firing frequencyRequires neuronal preparations

For rigorous characterization:

  • Measure current-voltage relationships from -80 to +80 mV in 10 mV increments

  • Determine voltage-dependence of activation (V₁/₂) using Boltzmann fits

  • Assess inactivation properties with prolonged depolarizations

  • Compare normalized conductance-voltage relationships between wild-type and variants

These approaches parallel methods used for human KCNC2 characterization in research settings .

How can researchers effectively distinguish between gain-of-function and loss-of-function rat Kcnc2 variants?

Comprehensive functional analysis requires multiple complementary approaches:

  • Electrophysiological parameters to examine:

    • Current density at multiple voltages

    • Voltage-dependence of activation (V₁/₂)

    • Activation and deactivation kinetics

    • Inactivation properties

  • Characteristic findings in gain-of-function variants:

    • Hyperpolarized shift in voltage-dependence of activation

    • Increased current density at hyperpolarized potentials

    • Altered channel kinetics

    • Example: Human R405G variant shows significantly higher current density between -40 and +10 mV and left-shifted conductance-voltage curve

  • Characteristic findings in loss-of-function variants:

    • Reduced current amplitude across voltage range

    • Depolarized shift in activation voltage

    • Slowed activation kinetics

    • Example: Some human GGE-associated variants show dramatic current reduction

  • Comparison methodology:

    • Always normalize to wild-type expressed under identical conditions

    • Perform experiments at physiological temperature (32-37°C) when possible

    • Use multiple expression levels to control for expression artifacts

What pharmacological tools are most useful for studying rat Kcnc2 channel function?

Various pharmacological agents can be employed to investigate Kcnc2 function:

CompoundMechanismResearch ApplicationExperimental Considerations
TEA (Tetraethylammonium)Pore blockerChannel identification, Current isolationRelatively selective at 1-5 mM
4-Aminopyridine (4-AP)K+ channel blockerNetwork effects of Kv3.2 inhibitionLess selective, affects multiple K+ channels
Valproic acid (VPA)Multiple mechanisms including K+ channel modulationTherapeutic relevancePotentially relevant for Kcnc2 variants based on clinical data showing VPA effectiveness in KCNC2-related epilepsies
Specific peptide toxinsSelective Kv3 family blockersDissecting channel subtype contributionsLimited commercial availability

VPA is particularly notable as clinical evidence from human KCNC2-related epilepsies indicates that patients with variants clustering in specific regions (N-terminal and extracellular regions of the third and fourth domains) show particularly good responses to VPA therapy .

How do rat Kcnc2 mutations affect neuronal circuit function and what are the best models to study these effects?

Investigating circuit-level effects of Kcnc2 mutations requires specialized approaches:

Model SystemAdvantagesApplicationsTechnical Considerations
Primary neuronal culturesControl over genetic manipulation, Accessibility for imaging and electrophysiologySingle-cell properties, Simple network dynamicsLimited circuit complexity
Acute brain slicesPreserved local circuits, Physiological cellular environmentCircuit dynamics, Synaptic physiologyTechnical complexity, Limited lifespan
In vivo models (transgenic rats)Complete circuit integration, Behavioral correlatesDisease modeling, Therapeutic testingResource intensive, Complex phenotyping

Key circuit-level parameters to assess:

  • Fast-spiking interneuron firing properties

  • Excitation-inhibition balance in local circuits

  • Network oscillatory properties

  • Seizure threshold in epilepsy-associated variants

Based on human KCNC2 studies, researchers should pay particular attention to interneuron function, as Kv3.2 is predominantly expressed in inhibitory interneurons, and dysfunction can lead to altered network excitability resembling that seen in epilepsy syndromes .

How can computational modeling enhance understanding of rat Kcnc2 channel dynamics and predict pathogenic variants?

Computational approaches provide powerful tools for Kcnc2 research:

  • Structural modeling applications:

    • Predict effects of mutations on channel structure using homology models

    • Identify critical amino acid interactions through conservation analysis

    • Visualize putative binding sites for pharmacological agents

  • Electrophysiological modeling:

    • Incorporate Kcnc2 kinetics into neuronal models to predict cellular effects

    • Simulate network-level consequences of channel dysfunction

    • Test hypotheses prior to resource-intensive experiments

  • Predictive algorithms for variant pathogenicity:

    • Paralog conservation scores (Para_zscore) identify critical regions shared across Kv3 family members

    • Missense tolerance ratio (MTR) quantifies constraint to variation in general population

    • Combined approaches improve prediction accuracy for functional impact

These computational approaches have proven valuable in human KCNC2 research, where paralog-conserved regions were found to be enriched for pathogenic variants, particularly in neurodevelopmental disorders .

How do findings from rat Kcnc2 studies translate to understanding human KCNC2-related disorders?

The translational relevance of rat Kcnc2 research extends to several human conditions:

Human DisorderAssociated KCNC2 PhenotypesRelevance of Rat ModelsResearch Considerations
Developmental and Epileptic Encephalopathy (DEE)Severe early-onset seizures, developmental delayModel severe gain-of-function variantsFocus on interneuron development and function
Genetic Generalized Epilepsy (GGE)Absence, myoclonic, or generalized tonic-clonic seizuresModel milder loss-of-function variantsExamine thalamocortical circuit function
Early-Onset Absence Epilepsy (EOAE)Childhood absence seizuresModel specific channel variantsFocus on thalamic rhythmogenesis
Focal Epilepsy (FE)Focal seizures with variable onsetRegion-specific expression studiesInvestigate regional vulnerability

When designing translational studies:

  • Consider that 8/18 patients with various human KCNC2-related epilepsies responded to valproic acid

  • More severe DEE phenotypes often associate with gain-of-function variants

  • Milder GGE phenotypes may associate with loss-of-function variants

  • Additional neurological features may include ataxia, speech disturbance, and autism spectrum disorder

What are the most promising therapeutic approaches targeting Kcnc2 dysfunction based on current research?

Emerging therapeutic strategies for Kcnc2-related disorders include:

  • Channel-specific approaches:

    • Modulators that normalize Kv3.2 function (compensating for gain or loss of function)

    • Targeting of specific binding sites identified through structural biology

    • Gene therapy approaches for severe loss-of-function variants

  • Network-based interventions:

    • Valproic acid shows particular promise based on clinical data from human KCNC2 variants

    • Compounds that restore excitation-inhibition balance

    • Interneuron-specific modulators

  • Personalized medicine considerations:

    • Variant-specific treatment selection (e.g., VPA for variants in specific regions)

    • Phenotype-guided therapy based on seizure type

    • Combination approaches targeting multiple mechanisms

Clinical evidence from human KCNC2-related epilepsy indicates that valproic acid is particularly effective in patients with variants clustering in the N-terminal region and extracellular region of the third and fourth domains. This suggests that understanding the specific functional impact of variants is crucial for treatment selection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.