Recombinant Rat Potassium voltage-gated channel subfamily C member 4 (Kcnc4)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant rat KCNC4 is typically produced via heterologous expression systems, with options tailored to functional and structural studies:

Expression SystemTags/PurificationAdvantagesApplications
Mammalian (HEK293)His-tag, Avi-tag, Fc-tagNative folding and post-translational modificationsStructural studies, antibody development .
Prokaryotic (E. coli)His-tag, Non-tagHigh yield, cost-effectiveBiochemical assays, binding studies .

For membrane protein stability, detergents like DDM or CHAPS are used during purification .

Research Applications and Pathways

KCNC4 is implicated in diverse physiological and pathological processes, as evidenced by its involvement in key signaling pathways:

Neuronal and Muscle Function

  • Neuronal Excitability: Regulates action potential repolarization, influencing neuronal firing rates .

  • Skeletal Muscle: Maintains resting membrane potential in muscle cells .

Cancer Progression

KCNC4 overexpression is linked to:

  • Oral Leucoplakias: Early biomarker for squamous cell carcinoma risk .

  • Head and Neck Cancers: Promotes malignant transformation and cell cycle progression .

Neurological Disorders

  • Alzheimer’s Disease: Overexpression observed in early stages, potentially exacerbating neurodegeneration .

  • Post-Spinal Cord Injury Pain: Dysregulation contributes to pain sensitization, suggesting therapeutic targeting .

Pathway Interactions
KCNC4 interacts with proteins in:

PathwayRelated Proteins
Neuronal SystemKCNMA1, KCNG3, KCND3
Potassium ChannelsKCNA2, KCNQ2, KCNH1
Voltage-Gated K+ ChannelsKCNC1, KCNH2, KCNS2

Cancer Research

  • Oral Squamous Cell Carcinoma: KCNC4 expression correlates with tumorigenesis onset, not progression .

  • Leukemia: Kv3.4 channels regulate irradiated leukemia cell survival via electrosignaling .

Neurological Studies

  • Post-Spinal Cord Injury (SCI) Pain: Kv3.4 blockade reduces pain hypersensitivity, highlighting its role in nociceptive pathways .

  • Alzheimer’s Disease: Early KCNC4 overexpression may disrupt neuronal ionic balance, accelerating pathology .

Challenges and Future Directions

  • Structural Complexity: Membrane protein instability requires optimized expression and detergent systems .

  • Species-Specific Variations: Rat KCNC4 studies may differ from human/mouse models in channel kinetics and disease relevance.

  • Therapeutic Potential: KCNC4 inhibitors could target cancer, pain, and neurodegenerative diseases, though selectivity remains a challenge .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Kcnc4; Potassium voltage-gated channel subfamily C member 4; Raw3; Voltage-gated potassium channel subunit Kv3.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-625
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnc4
Target Protein Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT RLAWLADPDGGGRPESDGGGAGSSGSSGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPA DVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGD DERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVS ITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEFLVR IVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFK LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTD FKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY SLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEETSPRDSTYSDTSPPAREEGMVERKRAD SKQNGDANAVLSDEEGAGLTQPLASAPTPEERRALRRSGTRDRNKKAAACFLLSAGDYAC ADGSVQKEGSVEPKACVPVSHTCAL
Uniprot No.

Target Background

Function
This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. The protein assumes open or closed conformations in response to the voltage difference across the membrane, forming a potassium-selective channel that facilitates potassium ion passage according to their electrochemical gradient.
Gene References Into Functions
  1. Data indicate ubiquitous expression of Kv3.4 potassium channel protein in nociceptors. PMID: 26039360
  2. Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2, induced by amyloid peptide, are implicated in apoptotic neuronal death. PMID: 17495071
  3. Kv3.4 is expressed in nociceptive dorsal root ganglion neurons and significantly diminishes following neuropathic pain. PMID: 17855600
  4. Given the role of Kv3 proteins in shaping neuronal excitability, these data highlight a role for homomeric Kv3.4 channels in spike timing and neurotransmitter release in low frequency firing neurons of the DVN. PMID: 18048010
  5. The 15-lipoxygenase pathway, via its metabolite, 15-hydroxyeicosatetraenoic acid, appears to play a role in the down-regulation of Kv3.4. PMID: 18430420

Show More

Hide All

Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.4/KCNC4 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of KCNC4 (Kv3.4) protein?

KCNC4 (Kv3.4) is an integral membrane protein belonging to the Kv3 subfamily of voltage-gated potassium channels. The protein contains 635 amino acid residues and features six transmembrane segments (S1-S6) with a voltage-sensor located in the S4 domain. Like other voltage-gated potassium channels, functional KCNC4 channels form as tetramers, with four α-subunits arranged circumferentially around a central pore. Each subunit contributes its S5-P-S6 sequence to line the ion-conduction pore, while the S1-S4 segments act as voltage-sensor domains that gate the pore by "pulling" on the S4-S5 linker in response to membrane potential changes .

Where is KCNC4 primarily expressed and what is its physiological function?

KCNC4 is primarily expressed in the brain and kidney. In heterologous expression systems, KCNC4 produces fast-inactivating A-type currents, in contrast to KCNC1 and KCNC2 which regulate slow-inactivation delayed rectifier-type currents. In skeletal muscle, KCNC4-containing voltage-gated potassium channels regulate the resting potential of muscle cells. The channel functions to transport potassium ions across the membrane according to their electrochemical gradient, altering its conformational state (open or closed) in response to voltage differences across the membrane .

How does KCNC4 differ from other members of the voltage-gated potassium channel family?

KCNC4 (Kv3.4) differs from other Kv3 subfamily members primarily in its inactivation kinetics. While KCNC1 (Kv3.1) and KCNC2 (Kv3.2) mediate slow-inactivating delayed rectifier currents, KCNC4 produces fast-inactivating A-type currents. This unique property is due to KCNC4's N-terminal inactivation domain (NTID), which enables rapid N-type inactivation. Additionally, KCNC4 appears to play specialized roles in certain tissues such as primary pain-sensing neurons, where it contributes to action potential repolarization. The functional diversity within the Kv channel family is further expanded through heteromultimerization, where KCNC4 can combine with other Kv3 subfamily members to form channels with intermediate properties .

What are the key considerations for designing experiments to study KCNC4 function?

When designing experiments to study KCNC4 function, researchers should:

  • Define clear variables:

    • Independent variables: Factors you will manipulate (e.g., membrane voltage, PKC activation, expression levels)

    • Dependent variables: Outcomes to measure (e.g., channel inactivation rate, current amplitude)

    • Control for extraneous variables: Factors that might confound results (e.g., temperature, expression of other channels)

  • Formulate specific hypotheses: Develop testable hypotheses about KCNC4 function or modulation. For example, "PKC activation will significantly slow KCNC4 channel inactivation."

  • Select appropriate experimental systems: Consider whether heterologous expression systems (e.g., HEK293 cells) or native tissues (e.g., DRG neurons) are more appropriate for your research question. Each system has advantages and limitations.

  • Choose sensitive recording techniques: For functional studies, employ electrophysiological techniques such as patch-clamping. Cell-attached patch-clamping with appropriate filtering (2-5 kHz, 4-pole Bessel filter) and sampling rates (10-50 kHz) provides high-resolution data for studying KCNC4 kinetics .

What electrophysiological protocols are most effective for characterizing KCNC4 currents?

For optimal characterization of KCNC4 currents, consider these protocols:

  • Voltage-step protocols: Apply depolarizing voltage steps from a negative holding potential (e.g., -80 mV) to various test potentials (e.g., -60 to +60 mV) to assess voltage-dependent activation.

  • Inactivation protocols: Use a two-pulse protocol with varying prepulse potentials followed by a test pulse to a fixed potential to determine steady-state inactivation properties.

  • Recovery from inactivation: Apply a two-pulse protocol with varying interpulse intervals to determine the time course of recovery from inactivation.

  • Tail current analysis: For studying deactivation kinetics, use protocols that include repolarization to different potentials after a depolarizing step.

  • Action potential clamp: To assess the channel's contribution to action potential waveforms, use prerecorded action potentials as voltage commands.

Recordings should be performed at controlled temperatures (typically room temperature, 21-24°C for in vitro studies). Use patch electrodes with tip resistances of 1-3 MΩ for optimal recording quality .

How can researchers effectively distinguish KCNC4 currents from other potassium currents in native systems?

Distinguishing KCNC4 currents from other potassium currents in native systems requires a multi-faceted approach:

  • Biophysical characterization: KCNC4 channels typically display rapid activation (1-2 ms) and fast N-type inactivation with a time constant of 15-30 ms at positive potentials. They activate at relatively depolarized potentials (V₁/₂ activation around 0 mV).

  • Pharmacological tools:

    • Apply selective Kv3 family blockers like tetraethylammonium (TEA) at low concentrations (0.1-1 mM)

    • Test sensitivity to 4-aminopyridine (4-AP) at millimolar concentrations

    • Verify insensitivity to dendrotoxin (which blocks Kv1 channels)

  • Molecular approaches:

    • Employ siRNA or shRNA to specifically knock down KCNC4 expression

    • Use single-cell qPCR to correlate KCNC4 expression with observed currents

    • Apply CRISPR-Cas9 gene editing in animal models

  • Heterologous expression comparisons: Express recombinant KCNC4 in expression systems and compare biophysical properties with native currents .

How does protein kinase C (PKC) modulate KCNC4 channel function?

PKC exerts profound regulatory effects on KCNC4 channel function through phosphorylation of the channel's N-terminal inactivation domain (NTID). This modulation has significant physiological implications:

  • Mechanism of modulation:

    • PKC phosphorylates four serine residues within the KCNC4 NTID

    • This phosphorylation triggers cooperative conformational changes that render the NTID unstructured

    • The modified NTID becomes incapable of causing fast N-type inactivation

    • The result is a dramatic slowing of channel inactivation

  • Functional consequences:

    • Enhanced ability to repolarize action potentials when inactivation is slowed

    • Increased influence on calcium-dependent processes in neurons

    • Modified firing properties in excitable cells expressing KCNC4

  • Physiological relevance:

    • In dorsal root ganglion neurons, this modulation shapes action potential repolarization

    • May influence nociception and pain signaling pathways

    • Potentially becomes dysregulated in chronic pain conditions

What methods can be used to study post-translational modifications of KCNC4?

Studying post-translational modifications (PTMs) of KCNC4 requires a combination of biochemical, biophysical, and molecular approaches:

  • Phosphorylation-specific antibodies: Use antibodies that recognize specific phosphorylated residues within KCNC4. While the search results don't mention KCNC4-specific phospho-antibodies, source indicates availability of related channel phospho-antibodies that could serve as a methodological model.

  • Mass spectrometry:

    • Use immunoprecipitation to isolate KCNC4 proteins

    • Perform tryptic digestion followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Analyze data using appropriate software for PTM identification

  • Site-directed mutagenesis:

    • Create phosphomimetic mutants (e.g., serine to aspartate) to simulate constitutive phosphorylation

    • Generate phosphoresistant mutants (e.g., serine to alanine) to prevent phosphorylation

    • Express these mutants in heterologous systems and compare functional properties

  • Functional correlates:

    • Use patch-clamp electrophysiology to measure changes in channel kinetics after treatment with PKC activators (e.g., phorbol esters) or inhibitors

    • Correlate biophysical changes with biochemical evidence of phosphorylation

How do KCNC4 channels contribute to action potential repolarization in neurons?

KCNC4 channels play a significant role in action potential repolarization in neurons, particularly in specialized neuronal populations:

  • Biophysical properties supporting this function:

    • Rapid activation kinetics allow KCNC4 to respond quickly during action potentials

    • High voltage activation threshold means channels activate primarily during the repolarization phase

    • When N-type inactivation is slowed (e.g., by PKC phosphorylation), the channel's contribution to repolarization is enhanced

  • Cell-specific contributions:

    • In dorsal root ganglion neurons, KCNC4 underlies a robust high voltage-activated A-type K⁺ current

    • This current influences the repolarization phase of the action potential

    • The modulatory effect of PKC on KCNC4 inactivation provides a mechanism for dynamic regulation of action potential shape

  • Functional implications:

    • By influencing action potential repolarization, KCNC4 channels affect calcium entry

    • This modulation impacts calcium-dependent processes like neurotransmitter release

    • In pain-sensing neurons, KCNC4-mediated repolarization may influence nociceptive signaling

What is known about KCNC4's role in cancer development and progression?

KCNC4 has been implicated in several cancer types, with evidence suggesting it may serve as a biomarker and potential therapeutic target:

  • Oral squamous cell carcinomas (OSCC):

    • Abnormal KCNC4 expression is observed in oral leucoplakias (precancerous lesions)

    • Early occurrence and high prevalence of abnormal expression support KCNC4's role in OSCC tumorigenesis

    • Evidence suggests KCNC4 is more involved in tumorigenesis than in disease progression or outcomes

  • Head and neck squamous cell carcinomas:

    • KCNC4 plays an important role in development and progression

    • Proposed as a biomarker for cancer risk assessment

  • Leukemia:

    • Electrosignaling mediated by KCNC4 channels may regulate cell cycle and survival in irradiated leukemia cells

    • Suggests a potential role in treatment response

  • Mechanisms of action:

    • Like other Kv channels, KCNC4 may influence cancer cell proliferation, apoptosis, and migration

    • May affect membrane potential, which in turn regulates calcium signaling and cell volume

    • Could participate in signaling pathways that drive cellular proliferation

How is KCNC4 involved in neurological disorders such as Alzheimer's disease?

KCNC4 shows altered expression and function in neurological disorders, particularly Alzheimer's disease (AD):

  • Expression changes in Alzheimer's disease:

    • KCNC4 overexpression is observed in early stages of Alzheimer's disease

    • This overexpression persists into advanced stages

    • Suggests KCNC4 may be involved in disease pathogenesis rather than being a consequence

  • Proposed mechanisms:

    • Altered KCNC4 function may contribute to neuronal hyperexcitability in AD

    • Kv3.4 subunits appear to play a role in apoptotic processes relevant to AD

    • May interact with pathological substrates like amyloid-β or hyperphosphorylated tau

  • Potential as a therapeutic target:

    • The early involvement of KCNC4 in AD suggests it could be a target for early intervention

    • Modulating KCNC4 function might affect disease progression

    • Understanding KCNC4's role may provide insights into other neurodegenerative conditions

What is the evidence for KCNC4 involvement in pain sensitization after spinal cord injury?

Research indicates that KCNC4 channel dysregulation contributes to pain sensitization following spinal cord injury (SCI):

  • Experimental evidence:

    • Studies highlight a novel peripheral mechanism of post-SCI pain sensitization involving KCNC4 channel dysregulation

    • Changes in KCNC4 expression or function appear to contribute to altered sensory neuron excitability

  • Therapeutic implications:

    • Research suggests potential for Kv3.4-based therapeutic interventions for managing post-SCI pain

    • Targeting KCNC4 could provide a novel approach to treating neuropathic pain conditions

  • Mechanistic considerations:

    • Altered phosphorylation state of KCNC4 may contribute to hyperexcitability

    • Changes in channel expression, localization, or properties might disrupt normal sensory processing

    • Interaction with inflammatory mediators could exacerbate these effects

How do heteromeric assemblies with other Kv3 subfamily members affect KCNC4 function?

Heteromeric assembly with other Kv3 subfamily members creates functional diversity in KCNC4-containing channels:

  • Heterotetramer formation:

    • KCNC4 can combine with other Kv3 subfamily members (Kv3.1-3.3)

    • These combinations form functional heterotetrameric channels with properties distinct from homomeric channels

    • Assembly is regulated through subfamily-specific tetramerization domains

  • Functional consequences:

    • Heteromeric channels typically display intermediate biophysical properties

    • When KCNC4 combines with non-inactivating Kv3 subunits (e.g., Kv3.1), the resulting channels show partial inactivation

    • The ratio of different subunits affects the degree of inactivation and other properties

  • Physiological significance:

    • Heteromeric assembly provides a mechanism for fine-tuning neuronal excitability

    • Tissue-specific expression patterns of different Kv3 subunits create regional variations in channel properties

    • Developmental changes in subunit expression can alter neuronal firing properties during maturation

What experimental approaches can determine the stoichiometry of heteromeric KCNC4 channels?

Determining the stoichiometry of heteromeric KCNC4 channels requires specialized techniques:

  • Fluorescence-based approaches:

    • Förster resonance energy transfer (FRET) between differently labeled subunits

    • Single-molecule photobleaching of fluorescently tagged subunits

    • Fluorescence intensity analysis to determine subunit ratios

  • Biochemical methods:

    • Co-immunoprecipitation with subunit-specific antibodies

    • Blue native polyacrylamide gel electrophoresis (BN-PAGE)

    • Chemical crosslinking followed by mass spectrometry

  • Functional characterization:

    • Expression of tandem constructs with defined stoichiometry

    • Comparison of single-channel properties in patches with different potential stoichiometries

    • Detailed kinetic analysis of macroscopic currents

  • Computational approaches:

    • Modeling of channel behavior based on different stoichiometric arrangements

    • Fitting experimental data to predictions based on different subunit combinations

What are the molecular mechanisms of N-type inactivation in KCNC4 channels?

N-type inactivation in KCNC4 channels involves a distinct molecular mechanism:

  • Structural basis:

    • The N-terminal inactivation domain (NTID) acts as an inactivation particle or "ball"

    • This domain enters and occludes the internal mouth of the channel pore

    • The process is often described by the "ball-and-chain" mechanism

    • Four serine residues within the NTID are critical for modulation of inactivation

  • Conformational changes:

    • PKC-dependent phosphorylation triggers cooperative conformational changes in the NTID

    • These changes render the NTID unstructured

    • The modified NTID becomes incapable of causing fast N-type inactivation

    • This mechanism provides a molecular basis for dynamic regulation of channel function

  • Kinetic properties:

    • Fast onset (typically 15-30 ms) at depolarized potentials

    • Recovery from inactivation requires channel closure

    • Can be distinguished from C-type (slow) inactivation based on kinetics and modulation

  • Physiological significance:

    • Allows for rapid auto-regulation of K⁺ current

    • Provides a substrate for second messenger modulation of neuronal excitability

    • Contributes to frequency-dependent firing properties in neurons expressing KCNC4

What expression systems are most suitable for recombinant KCNC4 studies?

Selecting appropriate expression systems for recombinant KCNC4 studies depends on experimental goals:

  • Mammalian cell lines:

    • HEK293 cells: Widely used for voltage-clamp studies of ion channels

    • CHO cells: Provide stable expression with minimal endogenous K⁺ channels

    • Neuroblastoma cell lines (e.g., NG108-15): Offer a more neuron-like environment

  • Xenopus oocytes:

    • Advantages: Large size for two-electrode voltage clamp, robust expression

    • Limitations: Different post-translational modifications, temperature sensitivity

    • Useful for structure-function studies and initial characterization

  • Primary neuronal cultures:

    • More physiologically relevant environment

    • Can be used with viral vectors for KCNC4 expression

    • Allow study of interactions with neuronal proteins

  • Considerations for selection:

    • Expression level requirements (high vs. physiological)

    • Need for specific auxiliary subunits or interacting proteins

    • Type of experiments (biochemical vs. functional)

    • Temperature requirements (mammalian vs. amphibian)

What are the most effective strategies for validating KCNC4 knockdown or knockout models?

Effective validation of KCNC4 knockdown or knockout models requires a multi-level approach:

  • Molecular validation:

    • qPCR to confirm reduced mRNA expression

    • Western blotting to verify protein reduction

    • Single-cell qPCR for cell-specific knockdown confirmation

  • Functional validation:

    • Patch-clamp electrophysiology to demonstrate reduced high voltage-activated A-type K⁺ currents

    • Action potential waveform analysis to show predicted changes in repolarization

    • Calcium imaging to assess downstream effects on Ca²⁺-dependent processes

  • Pharmacological complementation:

    • Use of specific Kv3.4 modulators to confirm channel identity

    • Rescue experiments with wild-type KCNC4 expression

  • Controls and standards:

    • Include appropriate negative controls (scrambled siRNA, non-targeting CRISPR)

    • Compare multiple knockdown/knockout approaches

    • Validate across different experimental preparations

What bioinformatic resources are available for analyzing KCNC4 mutations and variants?

Several bioinformatic resources are available for analyzing KCNC4 mutations and variants:

  • Databases:

    • ActiveDriverDB: Contains information on KCNC4 (NM_004978) PTM sites and mutations

    • IUPHAR database: Provides comprehensive information on voltage-gated potassium channels

    • ClinVar: Offers data on clinically relevant variants

  • Analysis tools:

    • PROVEAN, SIFT, and PolyPhen-2: Predict functional effects of amino acid substitutions

    • MutationTaster: Evaluates disease-causing potential of sequence alterations

    • CADD: Scores the deleteriousness of single nucleotide variants and small insertions/deletions

  • Structural analysis resources:

    • Protein Data Bank (PDB): Contains structures of related K⁺ channels

    • Swiss-Model: Allows homology modeling of KCNC4 based on related channels

    • PyMOL or UCSF Chimera: Visualize and analyze structural impacts of mutations

  • Specific resources for KCNC4:

    • ActiveDriverDB shows that KCNC4 has 4 documented PTM sites and 128 known mutations

    • These resources can help researchers interpret the significance of variants identified in research or clinical settings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.