Recombinant Rat Potassium voltage-gated channel subfamily D member 2 (Kcnd2)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

Kv4.2 channels mediate rapidly inactivating A-type potassium currents (I<sub>to</sub>), crucial for action potential repolarization in neurons and cardiac cells . Key functional insights include:

  • Gating Dynamics: Channel inactivation is modulated by cytoplasmic residues (e.g., Glu323, Pro403, Val404). Mutations at these sites (e.g., E323K, P403A) disrupt inactivation kinetics, leading to prolonged depolarization .

  • Auxiliary Subunit Interactions:

    • Co-expression with KChIP2 or DPP6 β-subunits enhances surface expression and modifies gating:

      • KChIP2 accelerates activation kinetics in P403A mutants .

      • DPP6 stabilizes closed-state conformations, reducing current decay .

  • Heteromeric Assembly: Kv4.2 forms tetramers with Kv4.3 (KCND3), altering current density and voltage dependence .

Research Applications

Recombinant Rat Kcnd2 is pivotal in:

  • Electrophysiological Studies: Two-electrode voltage clamp in Xenopus oocytes reveals mutant channel dysfunction .

  • Pathogenic Variant Analysis: Four heterozygous missense variants (E323K, P403A, V404L, V404M) linked to global developmental delay and epilepsy show:

    VariantFunctional DefectPathogenicity Prediction Tools (CADD, REVEL)
    E323KMild loss-of-functionDeleterious (score >20)
    P403ASlowed activation/inactivationHighly deleterious
    V404L/MStrong gating impairmentPathogenic (Conservation score >90%)
  • Antibody Validation: Used as an antigen for monoclonal antibodies (e.g., ab204942, ab307710) in Western blot and immunohistochemistry .

Comparative Analysis with Orthologs

Recombinant Kcnd2 variants across species exhibit functional divergence:

SpeciesExpression SystemKey DifferencesApplications
Human (KCND2)YeastAltered glycosylation patternsCardiac electrophysiology studies
Mouse (Kcnd2)HEK293 cellsFaster inactivation kineticsNeuronal plasticity assays
ZebrafishE. coliEnhanced thermal stabilityDevelopmental biology models

Technical Considerations

  • Storage Stability: Lyophilized protein maintains activity for >6 months at -80°C but degrades after 3–4 freeze-thaw cycles .

  • Activity Assays: Optimal currents require co-expression with β-subunits (e.g., KChIP2) in heterologous systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
Kcnd2; Potassium voltage-gated channel subfamily D member 2; RK5; Shal1; Voltage-gated potassium channel subunit Kv4.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-630
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnd2
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKSFRI PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Uniprot No.

Target Background

Function
Voltage-gated potassium channel mediating transmembrane potassium transport in excitable membranes, primarily in the brain, but also in rodent heart. It plays a crucial role in mediating the majority of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials, and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. It contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which in turn regulates the circadian rhythm of locomotor activity. It functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. It mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. It forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. It can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Similarly, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity.
Gene References Into Functions
  1. A study revealed that ERK5 signaling promotes phosphorylation of Kv4.2 and inhibits the inactivation of the A-type current, enhancing membrane excitability in PC12 cells. PMID: 29996472
  2. Findings indicated: (i) seizures are associated with more brain damage, and neuronal damage is not the primary contributor to seizure generation in ischemic rats; (ii) the expression of IA channel subunit Kv4.2 is selectively reduced in ischemic rats with spontaneous behavioral seizures; (iii) The reduction of Kv4.2 may be linked to the long-term increased seizure susceptibility of ischemic rats. PMID: 27259067
  3. NMDA reduced both currents in a concentration-dependent manner, whereas there was no significant impact on the currents when perfused with MK-801. MDD rats exhibited significantly more fibrosis areas in heart tissue and reduced expression of Kv4.2, Kv4.3, and Cav1.2. PMID: 28566490
  4. Data demonstrate that voltage-gated K+ channel Kv4.2 is a target gene of microRNA miR-223-3p. PMID: 27322747
  5. 17betaestradiol suppresses epileptiform activity by enhancing Kv4.2-mediated transient outward potassium currents in primary hippocampal neurons. PMID: 26179130
  6. This study provides the first evidence for the role of H2S in regulating Ito potassium channels and identifies the specific motif in an ion channel labile for H2S regulation. PMID: 25756524
  7. Results suggest that the reduction of Kv4.2 expression could contribute to the development of postischemic seizures in hyperglycemia. PMID: 25043828
  8. Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4. PMID: 24811166
  9. This research demonstrates for the first time that Kv4.2 channels can self-organize to locally alter the excitability of the dendrite in the absence of any signaling resulting from synaptic potentiation. PMID: 24404150
  10. This study demonstrates the expression and function of Kv4.2 channels in neurons of the rat bed nucleus of the stria terminalis. PMID: 24037673
  11. Neuritin activates the insulin receptor pathway to up-regulate Kv4.2-mediated transient outward K+ current in rat cerebellar granule neurons PMID: 23066017
  12. The expression densities of Kv4.2 and Kv4.3 channels are significantly higher in type I neurons than in type II neurons. PMID: 22245500
  13. This study revealed significant differences in Kv4.2 and Kv4.3 mRNA levels in conditioned rats, with upregulation in the brain. PMID: 22700470
  14. Traumatic brain injury causes a transient downregulation of the kv4.2 channel subunit in hippocampal CA1 neurons, which is associated with hyperexcitability in the post-traumatic hippocampus and subsequently leads to seizures and epilepsy. PMID: 21895522
  15. These results indicate that distance-dependent Kv4.2 mobility is regulated by activity-dependent phosphorylation of Kv4.2 by PKA. PMID: 21472817
  16. Differential dorso-ventral distributions of Kv4.2 and HCN proteins confer distinct integrative properties to hippocampal CA1 pyramidal cell distal dendrites. PMID: 22511771
  17. Data suggest that the increase in current along the proximo-distal axis of pyramidal cell dendrites cannot be solely attributed to a corresponding increase in Kv4.2 channel number. PMID: 22098631
  18. Immunocytochemistry indicated that protein expression for Kv4.2 increased between 1 week and 4-5 weeks of age. PMID: 21451062
  19. Collectively, these results indicate that Kv4.2 mRNA levels are regulated in response to synaptic activity, and this phenomenon may be the mechanism underlying the homeostasis of Kv4.2 protein on dendritic surfaces. PMID: 21511008
  20. The K(V)4.2/K(V)4.3 channel forms a supramolecular complex with PKA through AKAP100 and is attached to caveolae by interacting with caveolin-3. PMID: 20224290
  21. Results indicate that Kv4.2 channels must regulate synaptic integration and plasticity through another mechanism in addition to their regulation of synaptic NR2 subunit composition. PMID: 20920553
  22. AKAP79/150 provides a platform for dynamic protein kinase A regulation of Kv4.2 expression, fundamentally impacting CA1 excitability. PMID: 21273417
  23. The dendritic localization of Kv4.2 mRNAs might regulate the dendritic surface level of Kv4.2 channels and synaptic plasticity. PMID: 21034530
  24. Findings show that the glutamate-induced downregulation of Kv4.2 is mediated by NR2B-containing NMDA receptors and is linked to proteolysis by calpain, which might contribute to the development of neuronal hyperexcitability and neurodegenerative diseases. PMID: 19857555
  25. Kv4.2 overexpression counteracted cardiac hypertrophy-related changes in isolated electrically and chemically stimulated cardiomyocytes PMID: 12403671
  26. An evolutionarily conserved dileucine motif is necessary for dendritic targeting of potassium channel Kv4.2 and is sufficient to target the axonally localized channels Kv1.3 and Kv1.4 to the dendrites PMID: 12592409
  27. Autocrine release of angiotensin II and endothelin 1 in diabetic and hypothyroid conditions attenuates K(+) currents by suppressing synthesis of potassium channels, the Kv4.2 component here, with effects mediated by protein kinase C-epsilon PMID: 12626328
  28. Zinc-mediated tetramerization is also a physiologically significant event for full-length functional channel formation. PMID: 12754210
  29. Crystal structure of the Kv4.2 T1 domain PMID: 12835418
  30. Kv4.2 plays a vital role in producing the A-type current in striatal cholinergic interneurons throughout postnatal development. PMID: 12843309
  31. Increased numbers and altered distribution of Kv4.2 channels at the cell surface are primarily the result of reorganization of the actin cytoskeleton. PMID: 14551056
  32. Hippocampal dentate granule and CA3 pyramidal cells and cerebellar granule cells express high levels of colocalized Kv4.2 and Kv4.3, which coassociate with KChIPs 1-4. These channels may play a significant role as modulators of somatodendritic excitability. PMID: 15356203
  33. Zinc(2+)-less potassium voltage gated(Kv4.2) channels expressed with KChIP3 protein demonstrate several distinct kinetic changes in channel gating PMID: 15485870
  34. DPP10 modulates Kv4.2-mediated A-type potassium channels PMID: 15671030
  35. A-type potassium channels containing Kv4.2 play a critical role in regulating postsynaptic excitability at the cerebellar mossy-fiber/granule cell synapse. PMID: 15736227
  36. In conclusion, the native neuronal subthreshold A-type channel is likely a macromolecular complex formed from Kv4 and a combination of both KChIP and DPL proteins. PMID: 16123112
  37. These findings suggest that Kv4.2 is the major contributor to the A-current in hippocampal CA1 neurones. PMID: 16141270
  38. Data from this study suggest that Kv4.2 subunits could be involved in pain modulation. PMID: 16176357
  39. This study reveals the molecular basis of A-type current increase in central neurons and demonstrates that endogenous production of Amyloid beta is crucial in the modulation of Kv4.2 and Kv4.3 subunit expression. PMID: 16271805
  40. Data support the hypothesis that expression of A-type K(+) channel alpha subunits Kv4.2 and Kv4.3 may protect somatic motoneurons, and possibly also interneurons, from naturally occurring cell death during developmental selection. PMID: 16553778
  41. Our findings establish a specific role for native Kv4.2 transcripts in forming and maintaining I(SA) current at characteristic levels in hippocampal pyramidal neurons PMID: 17026528
  42. Data show that in the Kv4.2+KChIP3+DPP10 channel complex, all DPP10 variants accelerate channel gating kinetics; however, the splice variant DPP10a produces uniquely fast inactivation kinetics that accelerates with increasing depolarization. PMID: 17475505
  43. Coexpression of Kv4.2 with STX1A resulted in a reduction of Kv4.2 current amplitude; caused a depolarizing shift of the steady-state inactivation curve; enhanced the rate of current decay; accelerated the rate of recovery from inactivation. PMID: 17725325
  44. Taken together, our results suggest that excitatory neurotransmission affects neuronal excitability via the regulation of the K+ channel membrane translocation. PMID: 18088376
  45. These results demonstrate a glutamate-induced alteration of Kv4.2 channels in cultured hippocampal neurons, which may be involved in activity-dependent changes of neuronal excitability and synaptic plasticity. PMID: 18363830
  46. Evidence for highly non-uniform subcellular distribution of A-type Kv4.2 potassium channels predicts their involvement in novel forms of intercellular communication in the olfactory pathway. PMID: 18371079
  47. Increased extracellular signal-regulated kinase (ERK) phosphorylation of Kv4.2 and decreased levels of Kv4.2 channels in the post-synaptic membrane of hippocampal neurons contribute to hyperexcitability during status epilepticus. PMID: 18513371
  48. Data suggest that the expression of Kv4.2 channels in the failing heart is redox-regulated by the thioredoxin system. PMID: 18515646
  49. Interaction between transcription factors Iroquois proteins 4 and 5 controls cardiac potassium channel Kv4.2 gene transcription across the left ventricular wall of rodent hearts. PMID: 18815185
  50. mRNA expression for Kcnd2 and Kcne2 was significantly reduced in diabetic rats, which may underlie delayed propagation of electrical activity in the ventricular myocardium PMID: 19267230

Show More

Hide All

Database Links
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell membrane, sarcolemma. Cell junction. Membrane, caveola.
Tissue Specificity
Detected in brain cortex, hippocampus, dentate gyrus, thalamus and cerebellum. Detected in neurons from the primary visual cortex. Detected in the supraoptic nucleus in hypothalamus, in hippocampus and the habenular nucleus of the thalamus. Detected in th

Q&A

What is the primary physiological function of Kcnd2 (Kv4.2) in neuronal tissues?

Kcnd2, also known as Kv4.2, is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. This channel plays a critical role in neuronal function by mediating the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials below the threshold for action potentials, making it crucial for regulating neuronal excitability .

Functionally, Kcnd2 serves multiple regulatory roles in neuronal signaling. It prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials, and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites . These functions collectively make Kcnd2 a key determinant of neuronal excitability and signaling patterns.

Additionally, Kcnd2 contributes to the regulation of circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which in turn regulates the circadian rhythm of locomotor activity. The channel also functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5 .

How does Kcnd2 differ from other potassium channel subfamilies?

Kcnd2 belongs to the voltage-gated potassium channel subfamily D, which has distinct structural and functional characteristics compared to other potassium channel families. While many potassium channels regulate membrane potential and cellular excitability, Kcnd2 specifically mediates the transient outward current I(to) in rodent heart left ventricle apex cells, though interestingly not in human heart, where this current is mediated by another family member .

Structurally, Kcnd2 forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Notably, Kcnd2 can form both functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3, with channel properties depending on the specific composition .

Unlike some other potassium channel families, Kcnd2 is particularly responsive to post-translational modifications such as phosphorylation by protein kinase C (PKC) and the ERK/MAPK pathway, allowing for dynamic regulation of its function in response to various cellular signaling events .

What are the standard methods for detecting and measuring Kcnd2 in rat samples?

Several established methods are available for detecting and quantifying Kcnd2 in rat samples, each with specific advantages depending on research objectives.

The Enzyme-Linked Immunosorbent Assay (ELISA) represents one of the most widely used approaches for precise quantification of Kcnd2 protein levels. Commercial ELISA kits for rat Kcnd2 typically offer high sensitivity (around 0.084ng/mL) and a detection range of 0.156-10ng/mL. These kits are optimized for use with serum, plasma, and cell culture supernatants, providing reliable and reproducible measurements .

For protein detection and localization, Western Blotting (WB) and Immunohistochemistry (IHC) using specific antibodies against Kcnd2 are valuable approaches. Recombinant monoclonal antibodies, such as rabbit anti-Kv4.2/KCND2, are suitable for multiple applications including Western blotting, immunohistochemistry on paraffin-embedded or frozen sections, immunoprecipitation, and flow cytometry .

At the transcript level, quantitative real-time polymerase chain reaction (qRT-PCR) provides a sensitive method for measuring Kcnd2 mRNA expression. This technique has been successfully employed in studies investigating the role of Kcnd2 in various physiological and pathological conditions, including cancer research .

How do post-translational modifications affect Kcnd2 channel function in different tissue contexts?

Post-translational modifications (PTMs) of Kcnd2 channels represent a sophisticated regulatory mechanism that fine-tunes channel function in a tissue-specific manner. In neuronal tissues, phosphorylation of Kcnd2 by various kinases, particularly PKC and ERK/MAPK pathways, significantly alters channel properties. PKC-mediated phosphorylation has been shown to modulate Kv4.2 channels, which are key components of rat ventricular transient outward K+ current . This modification affects channel kinetics, voltage-dependence, and current amplitude.

The cross-talk between PKC and ERK/MAPK pathways in regulating Kcnd2 function creates a complex regulatory network. Studies have established that Kv4.2 is a locus for PKC and ERK/MAPK cross-talk, allowing for integrated responses to diverse cellular signals . This multi-kinase regulation enables precise control of neuronal excitability under varying physiological demands.

In cardiac tissue, adrenergic modulation of Kcnd2 contributes to the regulation of the transient outward current. Research has demonstrated that molecular aspects of adrenergic modulation of the transient outward current involve phosphorylation events that modify Kcnd2 function . These modifications allow for rapid adaptation of cardiac electrophysiology in response to sympathetic and parasympathetic inputs, highlighting the dynamic nature of Kcnd2 regulation in the cardiovascular system.

What are the challenges in developing specific pharmacological modulators of Kcnd2 channels?

Developing specific pharmacological modulators for Kcnd2 channels presents multiple challenges stemming from structural, functional, and expression considerations. One primary obstacle is achieving sufficient subtype selectivity. Potassium channels share considerable structural homology, particularly within subfamilies. Kcnd2 can form both homotetrameric channels and heterotetrameric channels containing variable proportions of KCND2 and KCND3, with channel properties depending on this specific composition . This heterogeneity complicates the design of compounds that selectively target Kcnd2-containing channels.

Another challenge arises from the differential expression and function of Kcnd2 across tissues. While Kcnd2 mediates the transient outward current I(to) in rodent heart left ventricle apex cells, this function is performed by different channels in human heart . This species-specific functional divergence must be carefully considered when developing therapeutics intended for eventual clinical translation.

The complex regulation of Kcnd2 by auxiliary subunits and interacting proteins adds another layer of complexity. These interactions can significantly alter channel pharmacology, potentially rendering in vitro-effective compounds ineffective in vivo. Understanding the full complement of Kcnd2-interacting proteins in different cellular contexts is essential for designing modulators with predictable efficacy across physiological conditions.

What role does Kcnd2 play in circadian rhythm regulation and how does this impact experimental design?

Kcnd2 contributes significantly to the regulation of circadian rhythms through its effects on neuronal excitability in the suprachiasmatic nucleus (SCN). Research has demonstrated that Kcnd2 plays a role in regulating the circadian rhythm of action potential firing in SCN neurons, which subsequently regulates the circadian rhythm of locomotor activity . This function places Kcnd2 as an important molecular link between cellular electrophysiology and organismal behavioral rhythms.

The circadian involvement of Kcnd2 has profound implications for experimental design in both basic research and potential therapeutic applications. Studies investigating Kcnd2 function should carefully control for time-of-day effects, as channel expression and activity may vary throughout the circadian cycle. Experimental protocols should standardize the timing of tissue collection and functional measurements to minimize circadian variability.

In cardiac research, the connection between Kcnd2 and circadian rhythms becomes particularly relevant when studying arrhythmias. Studies have documented that circadian rhythms govern cardiac repolarization and arrhythmogenesis . This relationship is evidenced by clinical observations showing distinct circadian patterns in paroxysmal atrial fibrillation, with data from almost 10,000 episodes demonstrating clear temporal distribution patterns . Nocturnal atrial fibrillation has been specifically linked to mutations in KCND2, highlighting the importance of considering circadian timing in both experimental design and potential therapeutic interventions .

How does Kcnd2 expression correlate with gastric cancer progression and patient outcomes?

Analysis of TCGA database reveals that Kcnd2 expression is markedly elevated in gastric cancer and significantly correlates with different grades, T stages, and N stages . This elevation appears to have considerable prognostic value. Higher Kcnd2 expression levels in the TCGA database correlate with a more unfavorable prognosis for patients with gastric cancer, establishing Kcnd2 as an independent predictor of prognosis .

At the cellular level, Kcnd2 strengthens viability by boosting the proliferation of gastric cancer cells and reducing their death rate. Mechanistic studies have demonstrated that Kcnd2 enhances the proliferative abilities of gastric cancer cells by stimulating NF-κB both at cellular and animal levels . These findings suggest that Kcnd2 actively promotes gastric cancer progression rather than merely serving as a biomarker.

The prognostic significance of Kcnd2 varies across different patient subgroups, as illustrated in the table below:

Clinical cohortsKCND2 expressionHR (95% CI)p value
Differentiation
Poorly differentiated116 (Low), 49 (High)1.22 (0.8–1.85)0.35
Moderately differentiated18 (Low), 49 (High)1.7 (0.71–4.07)0.23
Well differentiated13 (Low), 19 (High)4.95 (1.62–15.06)0.0021 **
Perforation
No124 (Low), 45 (High)1.5 (0.98–2.29)0.058
Lauren classification
Instestinal165 (Low), 155 (High)1.87 (1.36–2.58)9.7e‐05 ****
Diffuse179 (Low), 62 (High)1.41 (0.98–2.03)0.063
Mixed9 (Low), 23 (High)3.5 (0.78–15.62)0.081

What mechanisms underlie Kcnd2's influence on immune cell infiltration in cancer microenvironments?

Research has uncovered compelling evidence that Kcnd2 modulates the tumor immune microenvironment, particularly through its effect on macrophage polarization. Animal studies have demonstrated that Kcnd2 regulates the immune system by promoting M2 macrophage differentiation, which plays a critical role in cancer progression . This finding suggests that Kcnd2's contribution to cancer development extends beyond direct effects on tumor cells to include immunomodulatory functions.

Mechanistically, Kcnd2 appears to promote M2 macrophage infiltration through activation of the NF-κB signaling pathway . NF-κB is a well-established regulator of inflammatory responses and immune cell function, and its activation by Kcnd2 creates a microenvironment conducive to tumor growth and progression. This mechanism provides a potential explanation for how a potassium channel can influence immune cell behavior within the tumor microenvironment.

The relationship between Kcnd2 expression and immune infiltration has been analyzed using the ESTIMATE algorithm, which provides stromal, immune cell, ESTIMATE, and tumor purity scores . These computational approaches, combined with experimental validation using flow cytometry and immunohistochemistry, have helped establish the immunomodulatory role of Kcnd2 in cancer progression, opening new avenues for potential therapeutic interventions targeting this pathway.

How are Kcnd2 mutations linked to cardiac arrhythmias, particularly nocturnal atrial fibrillation?

Genetic studies have established a causal relationship between mutations in KCND2 and specific cardiac arrhythmias, most notably nocturnal atrial fibrillation . These gain-of-function mutations alter the electrophysiological properties of cardiac cells, creating substrate conditions favorable for arrhythmogenesis. The mechanistic link between KCND2 mutations and nocturnal arrhythmias underscores the importance of this channel in maintaining normal cardiac rhythm, particularly during circadian cycle fluctuations.

The circadian dimension of KCND2-related arrhythmias is particularly noteworthy. Clinical data demonstrates distinct temporal patterns in paroxysmal atrial fibrillation episodes, with clear circadian distributions . Research has shown that circadian rhythms govern cardiac repolarization and arrhythmogenesis, with KCND2 serving as a molecular mediator of these temporal effects . This relationship explains why certain mutations in KCND2 specifically manifest as nocturnal arrhythmias rather than showing consistent effects throughout the day.

The connection between KCND2 mutations and cardiac disease extends our understanding of channelopathies—disorders caused by dysfunction of ion channels. Similar to mutations in other potassium channel genes like KCNJ2, KCNE1, and KCNH2 that have been linked to various cardiac arrhythmias, KCND2 mutations add to the spectrum of genetic factors underlying cardiac electrophysiological disorders . This knowledge facilitates genotype-phenotype correlations and may guide personalized therapeutic approaches for patients with specific channel mutations.

What are the optimal approaches for bioinformatic analysis of Kcnd2 expression data?

Bioinformatic analysis of Kcnd2 expression data requires careful consideration of data sources, normalization methods, and analytical pipelines. For comprehensive analysis, researchers typically utilize RNAseq data from established databases such as The Cancer Genome Atlas (TCGA) (https://portal.gdc.cancer.gov) and retrieve clinical information from complementary resources like UCSC XENA (https://xenabrowser.net/datapages/)[1].

Data preprocessing involves transformation into TPM (Transcripts Per Million) format and log2 transformation for both normal and cancer samples to ensure comparable expression scales. Visualization of Kcnd2 mRNA expression levels can be effectively accomplished using the ggplot2 package in R language, which provides flexible and aesthetically pleasing graphical representations .

For prognostic analysis, time-dependent ROC curves generated using the timeROC package help assess the predictive value of Kcnd2 expression for clinical outcomes. Survival analysis should be conducted using fitted survival regressions with the survival package, with results visualized using the survminer package . To identify significantly different genes associated with Kcnd2 expression for pathway enrichment analysis, Pearson's correlation test followed by GO and KEGG analysis using the clusterProfiler R package provides comprehensive functional insights .

What are the recommended protocols for studying Kcnd2 in animal models?

Animal models provide invaluable insights into Kcnd2 function in physiological and pathological contexts. When establishing cancer models to study Kcnd2's role in tumor progression, cell lines with different expression levels of Kcnd2 (such as control or Kcnd2 knockdown) can be injected subcutaneously into the lateral abdomen of mice. For gastric cancer research, MFC cells (2 × 10^5 in 50 μL PBS/per mouse) have been successfully utilized .

Experimental manipulation of inflammatory responses can help elucidate Kcnd2's immunomodulatory functions. Once tumors are established, mice can be injected with PBS or lipopolysaccharides (LPS, 1.5 mg/kg) through the peritoneal cavity to mimic inflammatory conditions . Tumor growth should be monitored regularly, with endpoint analysis conducted when the largest tumor in the control group reaches a predetermined size (approximately 1 cm diameter).

Following euthanasia, comprehensive analysis of tumors should include weighing, histological examination, immunofluorescence staining, flow cytometry for immune cell profiling, and qRT-PCR for gene expression analysis . These complementary approaches provide a multidimensional understanding of Kcnd2's effects on tumor biology. All animal experiments must be approved by the appropriate Institutional Animal Ethics Committee to ensure compliance with ethical standards and animal welfare regulations.

How can researchers effectively validate functional consequences of Kcnd2 mutations?

Validating the functional consequences of Kcnd2 mutations requires a multi-level approach combining molecular, cellular, and physiological assessments. At the molecular level, site-directed mutagenesis allows for the introduction of specific mutations into Kcnd2 expression constructs. These constructs can then be transfected into heterologous expression systems such as HEK293 cells or Xenopus oocytes for electrophysiological characterization.

Patch-clamp electrophysiology remains the gold standard for functional assessment of ion channel mutations. Both whole-cell and single-channel recordings provide valuable information about how mutations affect channel properties such as activation and inactivation kinetics, voltage dependency, and ion selectivity. These parameters directly link molecular alterations to cellular function and potentially to disease phenotypes .

For cardiac arrhythmia-associated mutations, additional validation approaches include optical mapping of cardiac tissue preparations and in vivo electrocardiographic monitoring in animal models expressing the mutant channels. The temporal dimension of arrhythmias, particularly those with circadian patterns like nocturnal atrial fibrillation, should be considered by conducting measurements across different time points in the circadian cycle . This comprehensive validation strategy ensures robust connections between genetic variations, molecular dysfunction, and clinical phenotypes.

What are the emerging therapeutic opportunities targeting Kcnd2 in cancer and neurological disorders?

Emerging research on Kcnd2's roles in cancer and neurological function reveals promising therapeutic avenues. In cancer therapy, the elevated expression of Kcnd2 in various malignancies, particularly gastric cancer, suggests its potential as both a biomarker and a therapeutic target . The finding that Kcnd2 activates NF-κB signaling and promotes M2 macrophage infiltration presents opportunities for dual-targeting approaches that address both cancer cell proliferation and the immunosuppressive tumor microenvironment.

Small molecule modulators of Kcnd2 channel function could potentially disrupt the pro-tumorigenic signaling pathways driven by this channel. Additionally, since Kcnd2 appears to be an independent predictor of prognosis in certain cancer subtypes, it may serve as a valuable biomarker for patient stratification, enabling more personalized treatment approaches .

In neurological disorders, Kcnd2's critical role in regulating neuronal excitability and action potential characteristics makes it a potential target for conditions characterized by neuronal hyperexcitability or altered firing patterns . The interconnection between Kcnd2 and circadian rhythms also suggests potential applications in sleep disorders and conditions with circadian disruption components.

How might integrative multi-omics approaches advance our understanding of Kcnd2 regulation networks?

Integrative multi-omics approaches offer powerful frameworks for uncovering the complex regulatory networks governing Kcnd2 expression and function. Combining genomic, transcriptomic, proteomic, and phenomic data can reveal the multilayered control mechanisms and context-specific functions of Kcnd2 across different tissues and disease states.

Genomic approaches, including whole-genome sequencing and genome-wide association studies, can identify genetic variants affecting Kcnd2 expression or function. These can be integrated with transcriptomic data from RNA-seq to establish expression quantitative trait loci (eQTLs) and alternative splicing patterns. Proteomic analysis, particularly focused on post-translational modifications and protein-protein interactions, can further reveal how Kcnd2 channel regulation occurs at the protein level .

Functional genomics, including CRISPR-based screens, can systematically identify genes that modify Kcnd2 function or expression. When combined with computational network analysis, these approaches can construct comprehensive regulatory networks centered on Kcnd2. Such integrative analysis has already yielded valuable insights in cancer research, as exemplified by the use of TCGA database analysis in conjunction with experimental validation to establish Kcnd2's role in gastric cancer progression and immune modulation .

What challenges remain in translating Kcnd2 research findings to clinical applications?

Despite significant advances in understanding Kcnd2 biology, several challenges must be addressed to successfully translate research findings into clinical applications. One fundamental challenge is the multifunctional nature of Kcnd2 across different tissues. While inhibiting Kcnd2 might benefit cancer treatment based on its pro-tumorigenic effects , the same intervention could potentially disrupt neuronal function or cardiac rhythm due to Kcnd2's critical roles in these tissues .

The development of tissue-specific or context-specific delivery methods will be essential to overcome this challenge. Technologies such as targeted nanoparticles, tissue-specific promoters for gene therapy, or spatially restricted delivery systems could help confine therapeutic interventions to the intended tissue compartment, minimizing off-target effects.

Another significant challenge lies in understanding the individual variation in Kcnd2 expression and function. As evidenced by the differential prognostic significance of Kcnd2 across gastric cancer subtypes , patient-specific factors significantly influence the relevance of Kcnd2 in disease processes. Developing predictive biomarkers to identify patients most likely to benefit from Kcnd2-targeted interventions will be crucial for successful clinical translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.