Recombinant Rat Potassium voltage-gated channel subfamily E member 1 (Kcne1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format we have in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in the order notes section and we will fulfill your request.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by a range of factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize its development.
Synonyms
Kcne1; Potassium voltage-gated channel subfamily E member 1; Delayed rectifier potassium channel subunit IsK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Minimal potassium channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcne1
Target Protein Sequence
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Uniprot No.

Target Background

Function
This protein serves as an ancillary component that assembles with a voltage-gated potassium channel complex composed of pore-forming alpha subunits. It plays a role in modulating the gating kinetics and enhancing the stability of the channel complex. When assembled with KCNB1, it modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Its assembly with KCNQ1/KVLQT1 is believed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel, characterized by an outward current that reaches steady state only after 50 seconds. Lastly, its assembly with KCNH2/HERG may influence the rapidly activating component of the delayed rectifying potassium current in the heart (IKr).
Gene References Into Functions
  1. In adult ventricular myocytes, KCNE1 maintains a stable presence on the cell surface, while KCNQ1 exhibits dynamic localization. KCNQ1 primarily resides in an intracellular reservoir under basal conditions but can translocate to the cell surface, leading to an increase in IKs amplitude in response to stress. PMID: 28611207
  2. Six differentially expressed genes (Kcne1, Rcan1, Mx1, Mx2, Tmprss2, and RGD1559516) were identified in the renal cortex, and three genes (Rcan1, Mx2, and Tmprss2) were identified in the renal medulla. PMID: 28064310
  3. KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells. PMID: 23504710
  4. currents generated by homomeric Kv1.4, Kv3.3, and Kv3.4 channels are all strongly suppressed by the single transmembrane domain ancillary (beta) subunits KCNE1 and KCNE2 PMID: 21943416
  5. KCNE1 and KCNE2 suppress currents generated by homomeric Kv1.4, Kv3.3, and Kv3.4 channels PMID: 21943417
  6. both the voltage-dependence and kinetics of gating were found to depend on the relative densities of KCNQ1 and KCNE1, suggesting the heart rhythm may be regulated by the relative expression of the auxiliary subunit PMID: 20962273
  7. resting membrane potential in stomach SMCs PMID: 11804849
  8. may play a role in the negative regulation of the exocrine pancreas by somatostatin. PMID: 11810210
  9. Expression of KCNQ1 and KCNE1 associated with early stages of spermatogenesis and with presence of undifferentiated healthy or neoplastic germ cells. KCNQ1/KCNE1 may be involved in K+ transport, probably during germ-cell development. PMID: 15389592
  10. Suggest that KCNE1 stabilizes KCNQ1 S4 segment in the resting state and slows the rate of transition to the active state, while KCNE3 stabilizes the S4 segment in the active state. PMID: 17698596
  11. Rat MinK and MiRP1 reduced Kv2.1 current density three- and twofold, respectively; slowed Kv2.1 activation (at +60 mV) two- and threefold, respectively; and slowed Kv2.1 deactivation less than twofold. PMID: 19219384

Show More

Hide All

Database Links

KEGG: rno:25471

STRING: 10116.ENSRNOP00000002717

UniGene: Rn.9734

Protein Families
Potassium channel KCNE family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Tissue Specificity
Expressed in the heart. Expressed in kidney. Expressed in estrogen-induced uterus.

Q&A

What is Kcne1 and what is its primary function in physiological systems?

Kcne1 is a regulatory subunit that assembles with voltage-gated potassium channel complexes, particularly KCNQ1. This association forms a functional channel complex that plays crucial roles in multiple physiological systems. The primary functions of KCNQ1/KCNE1 complexes include maintaining high K+ concentration in the endolymph of the inner ear, which is essential for normal hearing, and producing the cardiac delayed rectifier K+ current necessary for normal ventricular repolarization . The protein functions as a modulator of channel gating kinetics and enhances the stability of the channel complex rather than forming an ion channel itself.

How does Kcne1 differ structurally and functionally from other KCNE family members?

While all KCNE family members function as regulatory subunits for voltage-gated potassium channels, Kcne1 specifically modulates KCNQ1 to form channels crucial for inner ear and cardiac function. Unlike KCNE2, which can associate with KCNH2/HERG to form the rapidly activating component of the delayed rectifying potassium current in the heart (IKr), Kcne1 combines with KCNQ1 to produce the slowly activating component (IKs) . Furthermore, while KCNE3 partners with KCNQ1 in intestinal epithelia to regulate transepithelial chloride secretion, Kcne1's primary functional associations are in the inner ear and cardiac tissue, highlighting the tissue-specific roles of different KCNE family members .

What are the tissue-specific expression patterns of Kcne1 in rats?

Kcne1 demonstrates a regulated tissue-specific expression pattern in rats. Research has identified significant expression in:

  • Inner ear: Critical for K+ homeostasis in the endolymph

  • Cardiac tissue: Forms channels responsible for ventricular repolarization

  • Reproductive system: Expression in undifferentiated germ cells in 21-day-old rats and mostly confined to basal immature germ cells in adult rats

Importantly, Kcne1 is not expressed in Leydig and Sertoli cells of the testis . During development, Kcne1 expression is closely regulated, with expression patterns changing throughout the maturation process, particularly in reproductive tissues where it appears associated with early stages of spermatogenesis .

What rat models are available for studying Kcne1 function, and what are their characteristics?

Several rat models have been developed for studying Kcne1 function, with the deafness Kyoto (dfk) rat being particularly well-characterized. The WTC-dfk rat model carries an intragenic deletion in the Kcnq1 gene (which partners with Kcne1) and exhibits multiple phenotypes including:

  • Impaired weight gain

  • Deafness and imbalance resulting from marked reduction of endolymph

  • Prolonged QT interval in the electrocardiogram (ECG)

  • Gastric achlorhydria with hypertrophic gastric mucosa

  • Hypertension, suggesting Kcnq1/Kcne1 involvement in blood pressure regulation

This coisogenic rat model provides advantages over mouse models due to the rat's larger size, making clinical examinations, sampling, therapeutic administration, and manipulations more feasible for studying Kcne1-related functions .

How should researchers design experimental protocols to study Kcne1 function in different tissue types?

When designing experiments to study Kcne1 function, researchers should consider tissue-specific expression and partner subunits:

For inner ear studies:

  • Use cochlear preparations with intact endolymphatic structures

  • Measure endocochlear potential and K+ concentration

  • Examine morphological features, particularly Reissner's membrane integrity and hair cell viability

For cardiac function studies:

  • Implement ECG recordings to assess QT intervals

  • Consider both resting and exercise/stress conditions, as QT interval differences may be rate-dependent

  • Test arrhythmogenicity using programmed electrical stimulation

For reproductive system studies:

  • Examine developmental stages separately

  • Use immunohistochemistry to localize expression in specific cell populations

  • Compare expression in normal versus pathological conditions (e.g., seminomas)

For all tissue types, combining electrophysiological, biochemical, and morphological approaches provides the most comprehensive understanding of Kcne1 function.

What are the optimal conditions for reconstituting recombinant rat Kcne1 protein for functional studies?

For optimal reconstitution of recombinant rat Kcne1 protein:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The reconstituted protein should demonstrate >90% purity as determined by SDS-PAGE . For functional studies, researchers should consider co-expression with KCNQ1 and other potential interacting partners to recreate physiologically relevant channel complexes.

How do mutations in Kcne1 contribute to hearing and cardiac pathologies?

Mutations in Kcne1 contribute to several important pathologies through distinct mechanisms:

Jervell and Lange-Nielsen Syndrome (JLNS2):

  • Caused by recessive (homozygous) variants in Kcne1

  • Characterized by congenital profound sensorineural deafness and QT prolongation

  • Results from loss of K+ transport function in the inner ear and impaired cardiac repolarization

  • Four distinct Kcne1 variants have been associated with JLNS2

Romano-Ward Syndrome (RWS):

  • Caused by heterozygous missense variants of Kcne1

  • Characterized by QT prolongation with normal hearing

  • Results from dominant negative effects when mutant KCNE1 monomers co-assemble with wild-type KCNQ1 subunits

  • 44 different Kcne1 variants associated with RWS, including 42 missense alleles and 7 heterozygous truncating variants

Interestingly, the relationship between genotype and phenotype is complex. Some heterozygous carriers of truncating variants show normal QT intervals, while others exhibit RWS phenotypes, suggesting that the specific mutation location and functional consequences determine the clinical presentation .

What are the implications of Kcne1 expression in reproductive tissue for fertility research?

The discovery of Kcne1 expression in reproductive tissues opens important avenues for fertility research:

  • Developmental regulation: Kcne1 expression is closely regulated during testicular development, with expression in undifferentiated germ cells in immature rats and basal immature germ cells in adults

  • Pathological relevance: In rat testis atrophy with germ cell aplasia, Kcne1 is not expressed, while in human seminomas (characterized by undifferentiated germ cell proliferation), Kcne1 protein levels are elevated

  • Functional hypothesis: The presence of K+-rich fluid in seminiferous tubules suggests Kcne1/KCNQ1 involvement in K+ transport during germ cell development

These findings suggest that Kcne1 may serve as a marker for undifferentiated germ cells and could play a role in spermatogenesis. Future fertility research should investigate whether Kcne1 dysfunction contributes to male infertility and whether it could serve as a therapeutic target for certain forms of reproductive disorders.

How does the phenotypic expression of Kcne1 mutations differ between homozygous and heterozygous states?

The phenotypic expression of Kcne1 mutations shows distinct patterns based on zygosity:

Homozygous mutations:

  • Complete phenotype with both auditory and cardiac manifestations (JLNS2)

  • Profound congenital sensorineural deafness

  • Prolonged QT interval with risk of ventricular arrhythmias and sudden cardiac death

  • In animal models, collapsed Reissner's membrane and hair cell degeneration

Heterozygous mutations:

  • Variable phenotype depending on mutation type

  • Normal hearing in most cases

  • Missense mutations often cause QT prolongation (RWS)

  • Some truncating mutations may produce normal QT intervals in carriers

  • Dominant negative effects depend on the specific mutation

This complex genotype-phenotype relationship highlights the importance of comprehensive genetic screening and functional characterization of novel Kcne1 variants to accurately predict clinical outcomes and guide patient management.

What techniques can be used to study the interaction between Kcne1 and its partner subunits in native tissues?

Advanced techniques for studying Kcne1 interactions with partner subunits include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Kcne1 to pull down protein complexes from native tissues, followed by western blotting to identify interacting partners such as KCNQ1

  • Proximity ligation assay (PLA): Enables visualization of protein-protein interactions in situ with subcellular resolution, useful for mapping Kcne1 interactions in specific tissue compartments

  • Bioluminescence/Förster resonance energy transfer (BRET/FRET): For real-time monitoring of protein interactions in living cells when studying recombinant tagged proteins

  • Patch-clamp electrophysiology: Combined with pharmacological agents to functionally characterize native Kcne1-containing channels

  • Single-molecule imaging: To track the dynamics of Kcne1 assembly with partner subunits

These approaches revealed that KCNQ1 and KCNE1 associate in testis with expression closely regulated during development . Similar techniques can be applied to study other tissues where Kcne1 functions, potentially revealing tissue-specific interaction partners and regulatory mechanisms.

How do the electrophysiological properties of channels containing Kcne1 differ from those with other KCNE family members?

The electrophysiological properties of channels containing different KCNE family members show distinct characteristics:

PropertyKCNQ1/KCNE1KCNQ1/KCNE2KCNQ1/KCNE3
Activation kineticsSlowRapidConstitutively active
DeactivationSlowIntermediateSlow
Voltage dependenceStrongReducedMinimal
Current amplitudeIncreasedVariableIncreased
Primary tissue locationHeart, inner earStomachIntestine
Physiological roleIKs cardiac current, K+ secretion in inner earGastric acid secretionCl- secretion in intestinal epithelia

KCNQ1/KCNE1 channels produce the slowly activating component of the delayed rectifier K+ current in the heart (IKs) . In contrast, KCNQ1/KCNE2 forms channels that activate more rapidly and are crucial for gastric acid secretion, while KCNQ1/KCNE3 produces constitutively active channels important for transepithelial chloride secretion in the intestine . These functional differences underlie the tissue-specific roles of KCNE family members and explain why mutations in different KCNE proteins lead to distinct disease phenotypes.

What are the current challenges in developing therapeutic approaches targeting Kcne1-related disorders?

Several challenges exist in developing therapeutics for Kcne1-related disorders:

  • Tissue specificity: Kcne1 functions in multiple tissues, making targeted delivery challenging without affecting other systems

  • Complex stoichiometry: The precise subunit composition and stoichiometry of native channels remain incompletely understood, complicating drug design

  • Mutation heterogeneity: The wide variety of disease-causing mutations (44+ for RWS alone) with different mechanisms requires potentially different therapeutic approaches

  • Dominant negative effects: For missense mutations, overcoming dominant negative effects requires approaches beyond simple replacement therapy

  • Animal model limitations: While rodent models exist, their cardiac physiology differs from humans (e.g., much higher heart rates), complicating translational research

Current research using the WTC-dfk rat model represents a promising approach to overcome some of these challenges, as rat models offer advantages in size and physiological similarity to humans compared to mice . Gene therapy approaches targeting specific mutations and small molecules that can rescue trafficking or function of mutant channels are under investigation.

What are the critical quality control parameters for recombinant rat Kcne1 protein production?

Researchers should assess the following quality control parameters when producing or purchasing recombinant rat Kcne1:

  • Purity: Should exceed 90% as determined by SDS-PAGE

  • Protein integrity: Verify full-length expression (1-123 amino acids) by mass spectrometry or western blotting

  • Tag presence and accessibility: Confirm accessibility of protein tags (e.g., N-terminal 6xHis-tag) for purification and detection

  • Proper folding: Assess by circular dichroism or functional assays when co-expressed with partner subunits

  • Stability: Monitor shelf-life (typically 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form)

  • Batch consistency: Compare lot-to-lot variation in activity and purity

  • Endotoxin levels: For experiments involving cell culture or in vivo applications

Proper storage is critical - avoid repeated freeze-thaw cycles and store working aliquots at 4°C for no more than one week .

How can researchers distinguish between the effects of Kcne1 and other KCNE family members in experimental systems?

Distinguishing between effects of different KCNE family members requires multiple complementary approaches:

  • Specific antibodies: Use highly specific antibodies validated for selective detection of Kcne1 versus other family members in immunoblotting, immunohistochemistry, and immunoprecipitation

  • Genetic tools:

    • Selective knockdown using siRNA or shRNA with carefully designed sequences targeting unique regions

    • CRISPR/Cas9-mediated knockout of specific KCNE genes

    • Rescue experiments with selective re-expression of individual family members

  • Electrophysiological signatures:

    • KCNQ1/KCNE1: Slowly activating potassium current

    • KCNQ1/KCNE2: Rapidly activating current

    • KCNQ1/KCNE3: Constitutively active current

  • Pharmacological approaches:

    • Use of compounds with differential effects on channels containing specific KCNE subunits

    • Chromanol 293B shows different potency depending on which KCNE subunit is present

  • Tissue context:

    • Inner ear and cardiac tissue predominantly express KCNE1

    • Stomach predominantly expresses KCNE2

    • Intestine predominantly expresses KCNE3

These approaches should be used in combination to provide conclusive evidence for the specific involvement of Kcne1 versus other family members.

What are the considerations for experimental design when using recombinant Kcne1 versus native tissue preparations?

When deciding between recombinant protein and native tissue preparations, researchers should consider:

Recombinant Kcne1 advantages:

  • Control over protein sequence and modifications

  • Higher purity and defined composition

  • Ability to introduce specific mutations

  • Simplified system for mechanistic studies

  • Consistent supply and reproducibility

Native tissue preparation advantages:

  • Natural stoichiometry of channel components

  • Presence of all physiological regulatory factors

  • Authentic post-translational modifications

  • Relevant subcellular localization

  • Tissue-specific partner subunits

Experimental design considerations:

  • Research question specificity - mechanistic studies may benefit from recombinant systems, while physiological relevance requires native preparations

  • Include appropriate controls when using recombinant proteins (e.g., verify functional assembly with partner subunits)

  • Consider species differences when extrapolating between rat models and human applications

  • For native preparations, account for developmental stage and pathological conditions that may alter Kcne1 expression

  • When possible, validate findings from recombinant systems in native tissue preparations and vice versa

The optimal approach often combines both methodologies to leverage their complementary strengths.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.