Recombinant Rat Potassium voltage-gated channel subfamily G member 2 (Kcng2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Kv Channel Regulation

Kcng2 modulates Kv2.1 channel activity by altering current density and activation kinetics:

  • Electrophysiological Impact: Coexpression with KV2.1 increases peak current density by 30.4% at 50 mV depolarization and shifts the activation curve (3 mV negative V1/2) .

  • Structural Interaction: Protein-protein docking simulations show that Kcng2 binds to KV2.1’s voltage-sensing domain, influencing channel inactivation during cardiac repolarization .

Cardiac Research

  • Action Potential Modulation: Kcng2-KV2.1 channels regulate cardiac repolarization, with dysregulation linked to prolonged QT intervals and arrhythmias .

  • Embryonic Development: Knockout studies in rats suggest Kv channel subunits (e.g., Kcnh2) are essential for embryonic heart development, highlighting Kcng2’s potential role .

Neurological Studies

  • Neuronal Excitability: Kcng2-containing channels modulate neurotransmitter release and action potential duration in neurons .

Toxicological Screening

  • Chemical Interactions: Kcng2 expression is sensitive to environmental toxins (e.g., aflatoxin B1, cadmium), making it a biomarker for neuro/cardiotoxicity studies .

Research Tools and Reagents

  • Antibodies: Rabbit polyclonal anti-Kcng2 antibodies (e.g., HPA048628) enable immunohistochemistry and Western blotting .

  • 3D Structures: Predicted models of Kcng2-KV2.1 complexes aid in studying binding interfaces and mutagenesis effects .

Key Research Findings

Study FocusMethodologyOutcomeReference
Kcng2-KV2.1 InteractionPatch-clamp, dockingIncreased current density, altered activation kinetics
Cardiac RepolarizationKnockout modelsEmbryonic lethality in Kcnh2−/− rats
Environmental ToxicityMethylation analysisKcng2 promoter methylation by arsenic

Future Directions

  • Therapeutic Targeting: Kcng2’s role in arrhythmias warrants exploration as a drug target.

  • Structural Biology: Cryo-EM studies could resolve full-length Kcng2-KV2.1 complex architecture.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize development according to your requirements.
Synonyms
Kcng2; Potassium voltage-gated channel subfamily G member 2; Cardiac potassium channel subunit; Voltage-gated potassium channel subunit Kv6.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcng2
Target Protein Sequence
MARLPGHPEVPGAEPGSAVRGGRGGRGARARHVIINVGGCRVRLAWAALARCPLARLERL RACRGHDELLRVCDDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELA YWGIDEARLERCCLRRLRRREEEAAEARATPPARGPQTSPGRALGSGRLERGRRRLRDVV ENPHSGLAGKLFAYVSVAFVAVTAVGLCLSTMPDVRAEEERGECSTKCRNLFVLETVCVA WFSFEFLLRSLQAESKCAFLRTPLAIIDILAILPFYVSLLAGLAAGPTGSKMLERAGLVL RLLRALRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAEREL GAHRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHT FSRSYSELKEQQQRAASPEPVLREDSTRDDSTRSASATEDSSQDPETAGAAGSLPGPVGP
Uniprot No.

Target Background

Function
Potassium channel subunit. This protein modulates channel activity by shifting the threshold and the half-maximal activation to more negative values.
Database Links
Protein Families
Potassium channel family, G (TC 1.A.1.2) subfamily, Kv6.2/KCNG2 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in heart, in particular in right and left atrium, and detected at lower levels in the right and left ventricle.

Q&A

What is Kcng2 and what is its role in cellular physiology?

Kcng2 (also known as KCNF2 or KV6.2) is a gamma subunit of voltage-gated potassium channels. It belongs to the potassium channel, voltage-gated, subfamily G. Unlike pore-forming alpha subunits, Kcng2 functions as a modifier subunit that alters the properties of functional potassium channels when co-expressed with alpha subunits.

The primary physiological role of Kcng2-containing channels appears to be in cardiac action potential repolarization, specifically in delayed-rectifier type channels. Voltage-gated potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural perspectives, with diverse functions including regulation of neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume .

How does Kcng2 differ from other potassium channel subunits?

Kcng2 belongs to the modifier subfamily G of potassium channels, distinguishing it from pore-forming subunits like those in the KCNQ family. While KCNQ2 (subfamily Q member 2) forms functional channels with KCNQ3 that underlie the native M-current critical for neuronal excitability regulation , Kcng2 does not form functional homomeric channels. Instead, Kcng2 modifies the properties of channels formed by alpha subunits.

The structural and functional differences between potassium channel families include:

  • KCNQ channels (like KCNQ2): Form the M-channel, which is slowly activating and deactivating, and plays a critical role in neuronal excitability regulation .

  • EAG family channels: Exhibit holding potential-dependent activation kinetics, where hyperpolarization slows activation kinetics and depolarization accelerates them .

  • KCNG family (including Kcng2): Act as modifier subunits, altering the properties of channels formed by alpha subunits rather than forming functional channels independently .

What is the genomic context and structure of the Kcng2 gene?

The Kcng2 gene has the following genomic characteristics:

  • Location: Chromosome 18q23

  • Chromosome sequence: NC_000018.10 (79797938..79900100)

  • Total number of exons: 4

  • Gene ID: 26251

The gene encodes a protein that functions as a gamma subunit of voltage-gated potassium channels . The genomic structure of Kcng2 supports its role as a modifier subunit in potassium channel complexes.

What are essential considerations for designing experiments to study Kcng2 function?

When designing experiments to investigate Kcng2 function, researchers should consider the following methodological approaches:

  • Variable identification and control:

    • Independent variables: Expression levels of Kcng2, co-expression with different alpha subunits, membrane potential manipulations

    • Dependent variables: Channel kinetics, ion selectivity, current amplitude

    • Extraneous variables to control: Expression system characteristics, temperature, ionic composition of solutions

  • Hypothesis formulation:

    • Null hypothesis (H0): "Kcng2 expression does not alter the electrophysiological properties of potassium channels formed by alpha subunits"

    • Alternative hypothesis (H1): "Kcng2 expression significantly modifies the kinetics and/or conductance of potassium channels formed by alpha subunits"

  • Experimental treatments:

    • Systematic manipulation of Kcng2 expression levels

    • Co-expression with different alpha subunits to determine specificity

    • Voltage protocols designed to reveal changes in activation, inactivation, and deactivation kinetics

What expression systems are most suitable for recombinant Kcng2 research?

When selecting an expression system for recombinant Kcng2 research, researchers should consider these methodological options:

  • Xenopus oocytes:

    • Advantages: Well-established for potassium channel expression, large size facilitates electrophysiological recordings

    • Methodology: mRNA injection followed by two-electrode voltage clamp recordings after 2-3 days

    • Considerations: Post-translational modifications may differ from mammalian cells

  • Mammalian cell lines (HEK293, CHO):

    • Advantages: Mammalian processing of proteins, suitable for both electrophysiology and biochemical assays

    • Methodology: Transfection of expression vectors containing Kcng2 cDNA

    • Considerations: May have endogenous potassium channels that could complicate interpretation

  • Primary cardiac cells:

    • Advantages: Native cellular environment where Kcng2 naturally functions

    • Methodology: Viral transduction to overexpress or knock down Kcng2

    • Considerations: Complex background of native channels, requiring careful control experiments

The choice of expression system should align with specific research questions, considering the advantages and limitations of each approach.

How can electrophysiological techniques be optimized for studying Kcng2-containing channels?

Optimizing electrophysiological techniques for Kcng2 research requires:

  • Whole-cell patch-clamp protocols:

    • Design voltage protocols that can isolate Kcng2-modified currents

    • Include holding potentials that allow observation of potential holding potential-dependent effects (similar to what was observed with eag channels)

    • Apply specific blockers of other potassium channels to isolate Kcng2-modified currents

  • Solutions composition:

    • Carefully design internal and external solutions to study ion selectivity

    • Consider testing multiple cations (K+, Rb+, Cs+, Na+) to characterize permeability ratios

    • Include appropriate buffers and ATP to maintain channel function

  • Data analysis approaches:

    • Use detailed kinetic analyses to characterize activation and deactivation time constants

    • Apply Boltzmann fits to activation and inactivation curves

    • Compare results with and without Kcng2 co-expression to identify specific modifications

The methodology used for patch-clamp experiments should take into account that the kinetics of channel activation may depend strongly on holding membrane potential, as observed with other voltage-gated potassium channels .

What molecular mechanisms underlie Kcng2's modulation of potassium channel properties?

The molecular mechanisms through which Kcng2 modulates potassium channels likely involve:

  • Heteromultimerization with alpha subunits:

    • Kcng2, as a gamma subunit, likely assembles with alpha subunits to form heteromultimeric channels

    • This assembly may alter the stoichiometry and arrangement of the channel complex

    • The presence of Kcng2 subunits may introduce structural constraints that modify gating kinetics

  • Voltage-sensing domain interactions:

    • Kcng2 may influence the movement of voltage sensors in response to membrane potential changes

    • This could explain alterations in activation and deactivation kinetics of the resulting channels

  • Potential signaling pathway integration:

    • By analogy with KCNH2, which interacts with integrin β1 to form macromolecular complexes that phosphorylate FAK to activate AKT , Kcng2 might participate in similar signaling complexes

    • Such interactions could connect channel function to broader cellular signaling networks

Research approaches to elucidate these mechanisms should include structural studies, co-immunoprecipitation experiments, and functional electrophysiology with site-directed mutagenesis.

How does Kcng2 function compare with other modifier subunits in heteromeric channel formation?

Comparing Kcng2 with other modifier subunits reveals important functional distinctions:

  • Assembly preferences:

    • Kcng2, as a subfamily G member, likely forms heteromeric channels with specific alpha subunits

    • This contrasts with KCNQ2, which preferentially assembles with KCNQ3 to form M-channels

    • Different modifier subunits may have distinct alpha subunit preferences

  • Biophysical effects:

    • Kcng2-containing channels may have unique kinetic properties compared to channels with other modifier subunits

    • The contribution to delayed-rectifier currents suggests slower deactivation kinetics

    • These properties may be specialized for cardiac action potential repolarization

  • Regulatory mechanisms:

    • While KCNQ2/KCNQ3 channels are inhibited by M1 muscarinic receptors and activated by retigabine , the regulatory mechanisms for Kcng2-containing channels remain to be fully characterized

    • Different modifier subunits likely confer distinct pharmacological sensitivities

Further research using comparative electrophysiology and biochemical approaches would help elucidate the specific contributions of Kcng2 relative to other modifier subunits.

What role might Kcng2 play in cardiac developmental processes?

While the search results don't directly address Kcng2's role in cardiac development, insights can be drawn from studies of related potassium channels:

  • Potential developmental significance:

    • Given that Kcng2 contributes to cardiac action potential repolarization , it may be important for the proper electrical function of developing cardiac tissue

    • By analogy with Kcnh2, which is crucial for embryonic heart development , Kcng2 might play a role in cardiomyocyte maturation

  • Expression patterns:

    • Research should investigate whether Kcng2 shows developmental regulation in its expression

    • Temporal and spatial expression patterns could provide clues about developmental functions

  • Signaling pathway interactions:

    • Potassium channels can interact with developmental signaling pathways

    • Kcnh2 interacts with integrin β1 to activate AKT signaling, which is important for embryonic development

    • Similar interactions might exist for Kcng2, potentially linking it to developmental processes

Experimental approaches to investigate this question could include developmental expression profiling, conditional knockout studies, and investigation of potential signaling partners.

What strategies are effective for generating and validating Kcng2 knockout models?

Based on methodologies described for related potassium channels, effective strategies for Kcng2 knockout models include:

  • Embryonic stem cell-based approaches:

    • Homologous recombination in rat embryonic stem cells (rESCs), similar to the approach used for Kcnh2 knockout

    • Design of targeting vectors to disrupt the Kcng2 gene

    • PCR and Southern blotting for confirmation of correct targeting

  • Validation methods:

    • Genotyping protocols using genomic DNA extraction and PCR analysis

    • RT-PCR and Western blotting to confirm absence of Kcng2 mRNA and protein

    • Functional validation using electrophysiological recordings to demonstrate altered potassium currents

  • Phenotypic analysis:

    • Cardiac-specific analyses, given Kcng2's role in cardiac action potential repolarization

    • Electrophysiological studies of cardiac tissue or isolated cardiomyocytes

    • Developmental studies to assess potential embryonic phenotypes

The methodology described for Kcnh2 knockout generation provides a valuable template, including the use of puromycin selection for drug-resistant colonies and multiple validation steps .

What techniques are most informative for studying Kcng2 protein-protein interactions?

To investigate Kcng2 protein-protein interactions, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against Kcng2 to pull down protein complexes

    • Analyze precipitated proteins by Western blotting or mass spectrometry

    • Include appropriate controls to confirm specificity of interactions

  • Förster resonance energy transfer (FRET):

    • Generate fluorescently tagged Kcng2 and potential interacting proteins

    • Measure energy transfer between fluorophores as an indicator of protein proximity

    • Perform controls with non-interacting proteins to establish specificity

  • Proximity ligation assay (PLA):

    • Detect protein-protein interactions in situ with high sensitivity

    • Visualize and quantify interactions in their native cellular context

    • Particularly useful for detecting interactions in cardiac tissue samples

By analogy with KCNH2, which forms a complex with integrin β1 that is essential for preventing apoptosis via inhibition of FOXO3A , Kcng2 might form similar macromolecular complexes with signaling proteins that could be detected using these techniques.

How can researchers address challenges in the functional characterization of Kcng2-containing channels?

Functional characterization of Kcng2-containing channels presents specific challenges that can be addressed through:

  • Heterologous expression strategies:

    • Since Kcng2 is a modifier subunit, co-expression with appropriate alpha subunits is essential

    • Systematic testing of different alpha subunits to identify native partners

    • Use of expression vectors with different promoters to control relative expression levels

  • Electrophysiological approaches:

    • Implement holding potential variations to reveal potential voltage-dependent effects on channel kinetics, similar to what was observed with eag channels

    • Design voltage protocols that can discriminate between different channel populations

    • Apply specific pharmacological tools to isolate currents of interest

  • Single-channel analysis:

    • Complement whole-cell recordings with single-channel analysis

    • Examine how Kcng2 affects unitary conductance, open probability, and gating kinetics

    • Use stationary noise analysis as an alternative approach to estimate single-channel properties

These methodological approaches can help overcome the challenges associated with studying modifier subunits like Kcng2, which do not form functional channels on their own.

What signaling pathways might interact with Kcng2 function in normal and pathological states?

By examining related potassium channels, several signaling pathways potentially relevant to Kcng2 function can be identified:

  • AKT signaling pathway:

    • KCNH2 interacts with the AKT pathway via association with integrin β1

    • This pathway regulates cardiovascular development processes including growth, differentiation, and apoptosis

    • Kcng2 might similarly engage with AKT signaling in cardiac tissue

  • GSK-3β/β-catenin pathway:

    • In Kcnh2 knockout models, disruption of KCNH2/integrin β1 complex reduced AKT phosphorylation and deactivated the GSK-3β/β-catenin pathway

    • Similar interactions might exist for Kcng2, potentially linking channel function to developmental and pathological processes

  • FOXO3A-mediated apoptosis:

    • KCNH2 prevents apoptosis via inhibition of FOXO3A

    • Kcng2 might play a role in cell survival mechanisms through similar pathways

These potential pathway interactions suggest Kcng2 may have broader roles beyond simply modulating channel biophysics, potentially influencing cell survival, development, and pathological processes.

What is the current evidence for Kcng2's involvement in disease pathophysiology?

The available evidence suggests possible connections between Kcng2 and disease states:

  • Association with opioid dependence:

    • Genome-wide association studies have mapped multiple associations to calcium and potassium pathways, including Kcng2, in opioid dependence

    • This suggests potential roles in neuronal excitability relevant to addiction biology

  • Cardiac arrhythmias:

    • Given Kcng2's contribution to cardiac action potential repolarization , dysfunction could potentially contribute to arrhythmogenic disorders

    • By analogy with other potassium channels like KCNQ2, which is associated with epilepsy when mutated , Kcng2 mutations might contribute to cardiac electrical abnormalities

  • Developmental disorders:

    • If Kcng2 plays a role in cardiac development similar to Kcnh2 , mutations might contribute to congenital cardiac defects

    • Further research is needed to explore this possibility

Current evidence is limited, highlighting the need for additional research to fully understand Kcng2's potential roles in disease pathophysiology.

What are the most promising approaches for advancing our understanding of Kcng2 function?

Future research on Kcng2 should prioritize:

  • Comprehensive expression profiling:

    • Detailed analysis of Kcng2 expression across tissues and developmental stages

    • Single-cell transcriptomics to identify specific cell populations expressing Kcng2

    • Correlation of expression patterns with functional properties of different tissues

  • Structure-function studies:

    • Identification of key domains mediating interaction with alpha subunits

    • Determination of structural elements responsible for modulation of channel properties

    • Potential for cryo-EM studies of heteromeric channels containing Kcng2

  • Integrative physiology approaches:

    • Generation of conditional and tissue-specific knockout models

    • In vivo electrophysiology to assess cardiac function in these models

    • Investigation of potential compensatory mechanisms when Kcng2 is absent

These approaches would provide a more comprehensive understanding of Kcng2's physiological roles and potential as a therapeutic target.

How might computational modeling enhance our understanding of Kcng2-containing channel function?

Computational approaches offer valuable insights into Kcng2 function:

  • Molecular dynamics simulations:

    • Model the structure of Kcng2 based on homology with related channels

    • Simulate interactions with alpha subunits to predict structural rearrangements

    • Identify potential drug binding sites for targeted modulation

  • Cardiac action potential modeling:

    • Incorporate Kcng2-containing channel properties into cardiac cell models

    • Predict the impact of Kcng2 modulation on action potential characteristics

    • Simulate potential arrhythmogenic mechanisms related to Kcng2 dysfunction

  • Systems biology approaches:

    • Model the integration of Kcng2 function with broader signaling networks

    • Predict consequences of Kcng2 modulation on cardiac physiology

    • Identify potential compensatory mechanisms that might be activated in response to Kcng2 targeting

These computational strategies, combined with experimental validation, would provide a more comprehensive understanding of Kcng2's role in normal and pathological states.

What are the key considerations for researchers beginning work with recombinant Kcng2?

Researchers initiating studies on recombinant Kcng2 should consider:

  • Expression system selection:

    • Choose systems appropriate for specific research questions

    • Consider co-expression with relevant alpha subunits to form functional channels

    • Validate expression through multiple techniques (Western blotting, immunocytochemistry)

  • Functional characterization strategies:

    • Implement comprehensive electrophysiological protocols including varied holding potentials

    • Study multiple aspects of channel function (activation, inactivation, deactivation)

    • Use pharmacological tools to isolate specific currents

  • Experimental controls:

    • Include appropriate negative controls (expression vectors without Kcng2)

    • Use positive controls (well-characterized potassium channels)

    • Implement internal controls to account for variability between experiments

These considerations will help researchers establish robust experimental systems for investigating Kcng2 function and its potential roles in physiology and disease.

How can findings from Kcng2 research be integrated with broader neuroscience and cardiac physiology?

Integration of Kcng2 research with broader fields requires:

  • Collaborative approaches:

    • Engage researchers across disciplines (electrophysiology, development, signaling)

    • Combine in vitro findings with in vivo studies to establish physiological relevance

    • Relate channel biophysics to cellular and systems-level function

  • Translational perspectives:

    • Consider how Kcng2 modulation might contribute to therapeutic strategies

    • Investigate potential roles in cardiac disorders and other pathologies

    • Explore possible developmental implications based on expression patterns

  • Comparative analysis:

    • Examine Kcng2 function across species to identify conserved and divergent features

    • Compare with other modifier subunits to establish common principles

    • Relate to broader families of ion channels to identify unifying mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.